KEGG   Homo sapiens (human): 8669
Entry
8669              CDS       T01001                                 

Gene name
EIF3J, EIF3S1, eIF3-alpha, eIF3-p35
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit J
  KO
K03245  translation initiation factor 3 subunit J
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    8669 (EIF3J)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    8669 (EIF3J)
   03012 Translation factors [BR:hsa03012]
    8669 (EIF3J)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-40S particles
   Other pre-40S particles
    8669 (EIF3J)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    8669 (EIF3J)
SSDB
Motif
Pfam: eIF3_subunit YL1 DUF5093 Nop53
Other DBs
NCBI-GeneID: 8669
NCBI-ProteinID: NP_003749
OMIM: 603910
HGNC: 3270
Ensembl: ENSG00000104131
Vega: OTTHUMG00000131158
Pharos: O75822(Tbio)
UniProt: O75822 A0A024R5S5
Structure
PDB: 
3BPJ

Position
15q21.1
AA seq 258 aa
MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKK
EEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRL
KKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFL
EVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDL
ADYGGYDGGYVQDYEDFM
NT seq 777 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcgggggactcggactcctgggacgccgacgctttctcc
gtggaagacccagtgcggaaggtggggggcggcggcactgccggcggggaccgctgggaa
ggcgaggacgaggacgaggacgtcaaggataactgggatgacgatgatgatgaaaaaaaa
gaggaagcagaagtaaaaccagaggtaaaaatttcagaaaagaaaaaaatagcagagaag
ataaaagagaaagaacggcaacagaagaaaaggcaagaagaaattaaaaagaggttagaa
gaacccgaagaacctaaagtgctaacaccagaagaacaattagcagataaactgcggcta
aagaaattacaggaagagtcagacctcgaattagcaaaggaaacttttggtgttaataat
gcagtttatggaatagatgctatgaacccatcttcaagagatgactttacagagtttgga
aagttactaaaagataaaattacacaatatgaaaagtcactatattatgccagttttttg
gaagtcttagttcgagatgtgtgtatttcattggaaattgatgacttgaaaaaaattacc
aattcactgactgtgctttgcagtgaaaaacagaagcaagaaaagcaaagcaaagccaaa
aagaagaagaaaggtgtggttcctggagggggattaaaagccaccatgaaagatgatctg
gcagattatggtggttatgatggaggatatgtacaagactatgaagacttcatgtga

DBGET integrated database retrieval system