KEGG   Homo sapiens (human): 8671Help
Entry
8671              CDS       T01001                                 

Gene name
SLC4A4, HNBC1, KNBC, NBC1, NBC2, NBCe1-A, SLC4A5, hhNMC, kNBC1, pNBC
Definition
(RefSeq) solute carrier family 4 member 4
  KO
K13575  solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04964  Proximal tubule bicarbonate reclamation
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
Disease
H00429  Proximal renal tubular acidosis (RTA type 2)
H02310  Renal tubular acidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    8671 (SLC4A4)
   04976 Bile secretion
    8671 (SLC4A4)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    8671 (SLC4A4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   8671 (SLC4A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2 Fmp27_WPPW
Motif
Other DBs
NCBI-GeneID: 8671
NCBI-ProteinID: NP_001091954
OMIM: 603345
HGNC: 11030
Ensembl: ENSG00000080493
Vega: OTTHUMG00000129907
Pharos: Q9Y6R1(Tbio)
UniProt: Q9Y6R1 A0A024RD97
Structure
PDB: 

Position
4q13.3
AA seq 1079 aa AA seqDB search
MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHKEKKEKERI
SENYSDKSDIENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDG
QEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLP
QLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTN
PDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFI
AFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKA
KDRHDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTP
HDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLAT
VTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLF
NFSKDNNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDA
FKKMIKLADYYPINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYH
NTTFDWAFLSKKECSKYGGNLVGNNCNFVPDITLMSFILFLGTYTSSMALKKFKTSPYFP
TTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVPPFGENPWWV
CLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVICSLMALPW
YVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFI
PMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLC
LALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKK
KKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTSC
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgaagctgtcctggacagaggggcttccttcctcaagcatgtgtgtgatgaa
gaagaagtagaaggccaccataccatttacatcggagtccatgtgccgaagagttacagg
agaaggagacgtcacaagagaaagacagggcacaaagaaaagaaggaaaaggagagaatc
tctgagaactactctgacaaatcagatattgaaaatgctgatgaatccagcagcagcatc
ctaaaacctctcatctctcctgctgcagaacgcatccgattcatcttgggagaggaggat
gacagcccagctccccctcagctcttcacggaactggatgagctgctggccgtggatggg
caggagatggagtggaaggaaacagccaggtggatcaagtttgaagaaaaagtggaacag
ggtggggaaagatggagcaagccccatgtggccacattgtcccttcatagtttatttgag
ctgaggacatgtatggagaaaggatccatcatgcttgatcgggaggcttcttctctccca
cagttggtggagatgattgttgaccatcagattgagacaggcctattgaaacctgaactt
aaggataaggtgacctatactttgctccggaagcaccggcatcaaaccaagaaatccaac
cttcggtccctggctgacattgggaagacagtctccagtgcaagtaggatgtttaccaac
cctgataatggtagcccagccatgacccataggaatctgacttcctccagtctgaatgac
atttctgataaaccggagaaggaccagctgaagaataagttcatgaaaaaattgccacgt
gatgcagaagcttccaacgtgcttgttggggaggttgactttttggatactcctttcatt
gcctttgttaggctacagcaggctgtcatgctgggtgccctgactgaagttcctgtgccc
acaaggttcttgttcattctcttaggtcctaaggggaaagccaagtcctaccacgagatt
ggcagagccattgccaccctgatgtctgatgaggtgttccatgacattgcttataaagca
aaagacaggcacgacctgattgctggtattgatgagttcctagatgaagtcatcgtcctt
ccacctggggaatgggatccagcaattaggatagagcctcctaagagtcttccatcctct
gacaaaagaaagaatatgtactcaggtggagagaatgttcagatgaatggggatacgccc
catgatggaggtcacggaggaggaggacatggggattgtgaagaattgcagcgaactgga
cggttctgtggtggactaattaaagacataaagaggaaagcgccattttttgccagtgat
ttttatgatgctttaaatattcaagctctttcggcaattctcttcatttatctggcaact
gtaactaatgctatcacttttggaggactgcttggggatgccactgacaacatgcagggc
gtgttggagagtttcctgggcactgctgtctctggagccatcttttgcctttttgctggt
caaccactcactattctgagcagcaccggacctgtcctagtttttgagaggcttctattt
aatttcagcaaggacaataattttgactatttggagtttcgcctttggattggcctgtgg
tccgccttcctatgtctcattttggtagccactgatgccagcttcttggttcaatacttc
acacgtttcacggaggagggcttttcctctctgattagcttcatctttatctatgatgct
ttcaagaagatgatcaagcttgcagattactaccccatcaactccaacttcaaagtgggc
tacaacactctcttttcctgtacctgtgtgccacctgacccagctaatatctcaatatct
aatgacaccacactggccccagagtatttgccaactatgtcttctactgacatgtaccat
aatactacctttgactgggcatttttgtcgaagaaggagtgttcaaaatacggaggaaac
ctcgtcgggaacaactgtaattttgttcctgatatcacactcatgtcttttatcctcttc
ttgggaacctacacctcttccatggctctgaaaaaattcaaaactagtccttattttcca
accacagcaagaaaactgatcagtgattttgccattatcttgtccattctcatcttttgt
gtaatagatgccctagtaggcgtggacaccccaaaactaattgtgccaagtgagttcaag
ccaacaagtccaaaccgaggttggttcgttccaccgtttggagaaaacccctggtgggtg
tgccttgctgctgctatcccggctttgttggtcactatactgattttcatggaccaacaa
attacagctgtgattgtaaacaggaaagaacataaactcaagaaaggagcagggtatcac
ttggatctcttttgggtggccatcctcatggttatatgctccctcatggctcttccgtgg
tatgtagctgctacggtcatctccattgctcacatcgacagtttgaagatggagacagag
acttctgcacctggagaacaaccaaagtttctaggagtgagggaacaaagagtcactgga
acccttgtgtttattctgactggtctgtcagtctttatggctcccatcttgaagtttata
cccatgcctgtactctatggtgtgttcctgtatatgggagtagcatcccttaatggtgtg
cagttcatggatcgtctgaagctgcttctgatgcctctgaagcatcagcctgacttcatc
tacctgcgtcatgttcctctgcgcagagtccacctgttcactttcctgcaggtgttgtgt
ctggccctgctttggatcctcaagtcaacggtggctgctatcatttttccagtaatgatc
ttggcacttgtagctgtcagaaaaggcatggactacctcttctcccagcacgacctcagc
ttcctggatgatgtcattccagaaaaggacaagaaaaagaaggaggatgagaagaaaaag
aaaaagaagaagggaagtctggacagtgacaatgatgattctgactgcccatactcagaa
aaagttccaagtattaaaattccaatggacatcatggaacagcaacctttcctaagcgat
agcaaaccttctgacagagaaagatcaccaacattccttgaacgccacacatcatgctga

DBGET integrated database retrieval system