KEGG   Homo sapiens (human): 8674Help
Entry
8674              CDS       T01001                                 

Gene name
VAMP4, VAMP-4, VAMP24
Definition
(RefSeq) vesicle associated membrane protein 4
  KO
K08513  vesicle-associated membrane protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    8674 (VAMP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8674 (VAMP4)
Membrane trafficking [BR:hsa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    8674 (VAMP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaptobrevin MCU Fzo_mitofusin RIFIN Sec5 NPV_P10
Motif
Other DBs
NCBI-GeneID: 8674
NCBI-ProteinID: NP_003753
OMIM: 606909
HGNC: 12645
Ensembl: ENSG00000117533
Vega: OTTHUMG00000034788
Pharos: O75379(Tbio)
UniProt: O75379 Q6IAZ3
Position
1q24.3
AA seq 141 aa AA seqDB search
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQV
DEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIM
ALVAAILLLVIIILIVMKYRT
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaagtttaagcgccacctcaatgatgatgatgtcacaggttctgtgaaaagt
gaaaggagaaatcttttggaagatgattcagatgaagaagaggacttttttctaagggga
ccatctggaccaagatttggacctagaaatgataaaattaagcatgttcagaatcaagtg
gatgaagttattgatgtcatgcaagaaaatattacaaaggtaattgagagaggggagaga
ctagatgaactacaggacaaatcagaaagcttatcggataatgcaacagcttttagcaac
agatccaaacaacttcgaaggcaaatgtggtggcgtggatgcaaaataaaagccatcatg
gctttggttgctgctatccttttgctagtgattatcattcttatagtcatgaaataccgt
acttga

DBGET integrated database retrieval system