KEGG   Homo sapiens (human): 8675Help
Entry
8675              CDS       T01001                                 

Gene name
STX16, SYN16
Definition
(RefSeq) syntaxin 16
  KO
K08489  syntaxin 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
Disease
H00244  Pseudohypoparathyroidism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    8675 (STX16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8675 (STX16)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-TGN / EE
    8675 (STX16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNARE Syntaxin Syntaxin_2 MCPsignal TRP Erp_C EVI2A DUF5345 ETRAMP Prominin BRO1 DUF2116
Motif
Other DBs
NCBI-GeneID: 8675
NCBI-ProteinID: NP_001001433
OMIM: 603666
HGNC: 11431
Ensembl: ENSG00000124222
Vega: OTTHUMG00000033084
Pharos: O14662(Tbio)
UniProt: O14662
Position
20q13.32
AA seq 325 aa AA seqDB search
MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAAELDELADDRMALVSGI
SLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEH
AIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQ
SGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTLMVEEREREI
RQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNR
KMLVILILFVIIIVLIVVLVGVKSR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaggcgtttaaccgacgctttcttgttgttgcggaataattccatccaaaac
cggcagctgttagccgagcaagtgagtagtcacatcacctccagccctctgcattcacgt
agcattgctgcggagctggacgagcttgctgatgaccgtatggcactggtgtcaggcatc
agcttagatccagaagcagcgattggtgtgacaaaacggccacctcctaagtgggtggat
ggagtggatgaaattcagtatgatgttggccggattaagcagaagatgaaagaattggcc
agccttcatgacaagcatttaaacagacccaccctggatgacagcagcgaagaggaacat
gccattgagataactacccaagagatcactcagctcttccacaggtgccagcgtgccgtg
caggccctgccgagccgggcccgggcctgctccgagcaggaggggcggctgcttgggaac
gtggtggcctcgctggcgcaggccctgcaggaactctccaccagcttccggcacgcacag
tcaggctacctcaaacgcatgaagaatcgagaggaaagatcccagcattttttcgacaca
tcagtaccactaatggatgatggagacgataacactctttaccatcggggttttacagag
gaccagttagttctggtggagcagaacacactgatggtggaagagcgggaacgagagatt
cgccagattgtacagtccatttctgacctgaatgaaatattcagggacttaggggcgatg
attgtagaacagggtacagtccttgacagaattgactataacgttgaacagtcctgtatc
aaaactgaagatggtttgaaacagcttcacaaggcagaacagtatcaaaagaagaatcgg
aagatgcttgtgattttaatattatttgtcatcatcattgtgctcattgttgtcctcgtt
ggcgtgaagtctcgataa

DBGET integrated database retrieval system