KEGG   Homo sapiens (human): 8678
Entry
8678              CDS       T01001                                 

Gene name
BECN1, ATG6, VPS30, beclin1
Definition
(RefSeq) beclin 1
  KO
K08334  beclin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04215  Apoptosis - multiple species
hsa04371  Apelin signaling pathway
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
  Element
N00155  Autophagy-vesicle nucleation
N00177  KSHV vBCL2 to autophagy-vesicle nucleation
N00962  Mutation-inactivated ATXN3 to autophagy-vesicle nucleation
N00993  Mutation-caused aberrant Htt to autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    8678 (BECN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    8678 (BECN1)
   04136 Autophagy - other
    8678 (BECN1)
   04137 Mitophagy - animal
    8678 (BECN1)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    8678 (BECN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    8678 (BECN1)
   05014 Amyotrophic lateral sclerosis
    8678 (BECN1)
   05016 Huntington disease
    8678 (BECN1)
   05017 Spinocerebellar ataxia
    8678 (BECN1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8678 (BECN1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    8678 (BECN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8678 (BECN1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    8678 (BECN1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    8678 (BECN1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    8678 (BECN1)
SSDB
Motif
Pfam: APG6 APG6_N BH3 MT HAUS-augmin3 Exonuc_VII_L ERM FPP FTA4 V_ATPase_I NAPRTase_C GAS
Other DBs
NCBI-GeneID: 8678
NCBI-ProteinID: NP_001300927
OMIM: 604378
HGNC: 1034
Ensembl: ENSG00000126581
Vega: OTTHUMG00000180653
Pharos: Q14457(Tbio)
UniProt: Q14457 A0A024R1X5
Structure
PDB: 

Position
17q21.31
AA seq 450 aa
MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEE
ETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTG
DLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQL
QMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQ
LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFF
WDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggaagggtctaagacgtccaacaacagcaccatgcaggtgagcttcgtgtgccagcgc
tgcagccagcccctgaaactggacacgagtttcaagatcctggaccgtgtcaccatccag
gaactcacagctccattacttaccacagcccaggcgaaaccaggagagacccaggaggaa
gagactaactcaggagaggagccatttattgaaactcctcgccaggatggtgtctctcgc
agattcatccccccagccaggatgatgtccacagaaagtgccaacagcttcactctgatt
ggggaggcatctgatggcggcaccatggagaacctcagccgaagactgaaggtcactggg
gacctttttgacatcatgtcgggccagacagatgtggatcacccactctgtgaggaatgc
acagatactcttttagaccagctggacactcagctcaacgtcactgaaaatgagtgtcag
aactacaaacgctgtttggagatcttagagcaaatgaatgaggatgacagtgaacagtta
cagatggagctaaaggagctggcactagaggaggagaggctgatccaggagctggaagac
gtggaaaagaaccgcaagatagtggcagaaaatctcgagaaggtccaggctgaggctgag
agactggatcaggaggaagctcagtatcagagagaatacagtgaatttaaacgacagcag
ctggagctggatgatgagctgaagagtgttgaaaaccagatgcgttatgcccagacgcag
ctggataagctgaagaaaaccaacgtctttaatgcaaccttccacatctggcacagtgga
cagtttggcacaatcaataacttcaggctgggtcgcctgcccagtgttcccgtggaatgg
aatgagattaatgctgcttggggccagactgtgttgctgctccatgctctggccaataag
atgggtctgaaatttcagagataccgacttgttccttacggaaaccattcatatctggag
tctctgacagacaaatctaaggagctgccgttatactgttctggggggttgcggtttttc
tgggacaacaagtttgaccatgcaatggtggctttcctggactgtgtgcagcagttcaaa
gaagaggttgagaaaggcgagacacgtttttgtcttccctacaggatggatgtggagaaa
ggcaagattgaagacacaggaggcagtggcggctcctattccatcaaaacccagtttaac
tctgaggagcagtggacaaaagctctcaagttcatgctgacgaatcttaagtggggtctt
gcttgggtgtcctcacaattttataacaaatga

DBGET integrated database retrieval system