KEGG   Homo sapiens (human): 8682Help
Entry
8682              CDS       T01001                                 

Gene name
PEA15, HMAT1, HUMMAT1H, MAT1, MAT1H, PEA-15, PED, PED-PEA15, PED/PEA15
Definition
(RefSeq) proliferation and apoptosis adaptor protein 15
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DED
Motif
Other DBs
NCBI-GeneID: 8682
NCBI-ProteinID: NP_001284506
OMIM: 603434
HGNC: 8822
Ensembl: ENSG00000162734
Vega: OTTHUMG00000031605
Pharos: Q15121(Tbio)
UniProt: Q15121 B1AKZ4 Q96FS5
Structure
PDB: 

Position
1q23.2
AA seq 130 aa AA seqDB search
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNL
SYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEI
IKLAPPPKKA
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtacgggaccctcctgcaagacctgaccaacaacatcacccttgaagatcta
gaacagctcaagtcggcctgcaaggaagacatccccagcgaaaagagtgaggagatcact
actggcagtgcctggtttagcttcctggagagccacaacaagctggacaaagacaacctc
tcctacattgagcacatctttgagatctcccgccgtcctgacctactcactatggtggtt
gactacagaacccgtgtgctgaagatctctgaggaggatgagctggacaccaagctaacc
cgtatccccagtgccaagaagtacaaagacattatccggcagccctctgaggaagagatc
atcaaattggctcccccaccgaagaaggcctga

DBGET integrated database retrieval system