KEGG   Homo sapiens (human): 8687Help
Entry
8687              CDS       T01001                                 

Gene name
KRT38, HA8, KRTHA8, hHa8
Definition
(RefSeq) keratin 38
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    8687 (KRT38)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    8687 (KRT38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    8687 (KRT38)
   04147 Exosome [BR:hsa04147]
    8687 (KRT38)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     8687 (KRT38)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   8687 (KRT38)
  Exosomal proteins of other body fluids (saliva and urine)
   8687 (KRT38)
  Exosomal proteins of colorectal cancer cells
   8687 (KRT38)
  Exosomal proteins of melanoma cells
   8687 (KRT38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament CwsA
Motif
Other DBs
NCBI-GeneID: 8687
NCBI-ProteinID: NP_006762
OMIM: 604542
HGNC: 6456
Ensembl: ENSG00000171360
Vega: OTTHUMG00000133439
Pharos: O76015(Tdark)
UniProt: O76015
Position
17q21.2
AA seq 456 aa AA seqDB search
MTSSYSSSSCPLGCTMAPGARNVSVSPIDIGCQPGAEANIAPMCLLANVAHANRVRVGST
PLGRPSLCLPPTCHTACPLPGTCHIPGNIGICGAYGENTLNGHEKETMQFLNDRLANYLE
KVRQLEQENAELEATLLERSKCHESTVCPDYQSYFHTIEELQQKILCSKAENARLIVQID
NAKLAADDFRIKLESERSLRQLVEADKCGTQKLLDDATLAKADLEAQQESLKEEQLSLKS
NHEQEVKILRSQLGEKLRIELDIEPTIDLNRVLGEMRAQYEAMLETNRQDVEQWFQAQSE
GISLQDMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCLQNSLCEAEDRFGTELA
QMQSLISNVEEQLSEIRADLERQNQEYQVLLDVKTRLENEIATYRNLLESEDCKLPCNPC
STSPSCVTAPCAPRPSCGPCTTCGPTCGASTTGSRF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttcctacagcagctcctcatgccctctgggttgcaccatggctcctggagca
agaaatgtctctgtctctcccatcgacattgggtgccagcctggggcagaggccaacatt
gcccccatgtgccttttggccaacgtggcacatgccaaccgagtccgtgtggggtccact
cccctgggccgccccagcctctgtctgccgcctacctgccacactgcttgtcccttgcca
gggacctgccacattcctggcaacattggaatctgtggggcctatggtgaaaacaccctg
aatggccatgagaaggagaccatgcagttcctgaatgaccgcctggccaactacctggag
aaggtgcgccagctggagcaggagaatgcggagctggaggccacactcctcgagaggagc
aagtgccacgagtccaccgtgtgccccgactaccagtcttacttccacaccatcgaggag
ctccaacagaagatcctgtgcagcaaggccgagaatgccaggctgattgtacaaattgac
aatgccaagctggctgccgatgactttaggatcaagctggagagtgagcgctccctgcgc
cagctggtggaggcagacaagtgtgggacacagaagctcctggatgatgcgaccctggcc
aaggccgacctggaggcccagcaggagtccctgaaggaggagcagctctccctcaagagc
aaccacgagcaggaagtaaagattctgaggagtcagctgggggagaagctccggattgag
ctggacattgagcccaccattgacctgaacagggtgctgggggagatgcgggctcagtat
gaggccatgttggagaccaaccgccaggatgtggaacagtggttccaagcccagtctgaa
ggcatcagcctgcaggacatgtcctgctccgaggagctgcagtgctgccagtcggagatc
ctggagctgagatgcacggtgaatgccctggaggtggagcgccaagcccagcacaccttg
aaggactgtctgcagaactccctgtgtgaagccgaggaccgcttcggcacggagctggcc
cagatgcagagcctcatcagcaacgtggaggagcagctgtctgagatccgggccgacctg
gagcggcaaaaccaggagtaccaggtgctgctggacgtgaagacccggctggagaatgag
attgccacgtaccggaaccttctggaaagcgaggactgcaaactcccctgcaatccgtgc
tccacgtctccctcctgcgtgactgccccctgtgctcctcgcccaagctgtggcccctgc
accacctgtgggcccacctgtggagccagcaccaccggaagccgattctga

DBGET integrated database retrieval system