KEGG   Homo sapiens (human): 8688Help
Entry
8688              CDS       T01001                                 

Gene name
KRT37, HA7, K37, KRTHA7
Definition
(RefSeq) keratin 37
  KO
K07604  type I keratin, acidic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    8688 (KRT37)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    8688 (KRT37)
   04147 Exosome [BR:hsa04147]
    8688 (KRT37)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     8688 (KRT37)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   8688 (KRT37)
  Exosomal proteins of other body fluids (saliva and urine)
   8688 (KRT37)
  Exosomal proteins of colorectal cancer cells
   8688 (KRT37)
  Exosomal proteins of melanoma cells
   8688 (KRT37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament CwsA
Motif
Other DBs
NCBI-GeneID: 8688
NCBI-ProteinID: NP_003761
OMIM: 604541
HGNC: 6455
Ensembl: ENSG00000108417
Vega: OTTHUMG00000133606
Pharos: O76014(Tdark)
UniProt: O76014
Position
17q21.2
AA seq 449 aa AA seqDB search
MTSFYSTSSCPLGCTMAPGARNVFVSPIDVGCQPVAEANAASMCLLANVAHANRVRVGST
PLGRPSLCLPPTSHTACPLPGTCHIPGNIGICGAYGKNTLNGHEKETMKFLNDRLANYLE
KVRQLEQENAELETTLLERSKCHESTVCPDYQSYFRTIEELQQKILCSKAENARLIVQID
NAKLAADDFRIKLESERSLHQLVEADKCGTQKLLDDATLAKADLEAQQESLKEEQLSLKS
NHEQEVKILRSQLGEKFRIELDIEPTIDLNRVLGEMRAQYEAMVETNHQDVEQWFQAQSE
GISLQAMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCLQNSLCEAEDRYGTELA
QMQSLISNLEEQLSEIRADLERQNQEYQVLLDVKARLENEIATYRNLLESEDCKLPCNPC
STPASCTSCPSCGPVTGGSPSGHGASMGR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacctccttctacagcacctcctcatgccctctgggttgcaccatggctcctggagca
agaaatgtctttgtctctcctatcgatgttgggtgccagcctgtggcagaggccaatgct
gcctccatgtgcctcttggccaacgtggcacacgccaacagagtccgtgtggggtcgact
cccctgggccgccccagcctctgtctgcccccaaccagtcacactgcttgtcccttgcca
gggacctgtcacattcccggcaacatcggaatctgtggggcctacggcaaaaacaccctg
aatggccatgagaaggagaccatgaagttcctgaatgaccgcctggccaactacctggag
aaggtgcgccagctggagcaggagaatgcagagctggagaccacactcctcgagaggagc
aagtgccacgagtccaccgtgtgccccgactaccagtcctacttccgtacaatcgaggag
ctccagcagaagatcctgtgcagcaaggctgagaatgccaggctgattgtacaaattgac
aacgcgaagctggctgctgatgactttaggatcaagctggagagtgagcgctcccttcac
cagctggtggaggcggacaagtgcgggacgcagaagctcctggatgacgcgaccctggcc
aaggccgacctggaggcccagcaggagtccctgaaggaggagcagctctccctcaagagc
aaccacgagcaggaagtaaagattctgaggagtcagctgggggagaagttccggatcgag
ctggacattgagcccaccattgacctgaacagggtgttgggggagatgcgggctcagtac
gaggccatggtggagaccaaccaccaggatgtggaacagtggttccaagcccagtctgaa
ggcatcagcctgcaggccatgtcctgctccgaggagctgcagtgctgccagtcggagatc
ctggagctgagatgcacggtgaatgccctggaggtggagcgccaagcccagcacaccttg
aaggactgtctgcagaactccctgtgtgaagcggaggaccgctacggcacagagctggcc
cagatgcagagcctcattagcaacttggaagagcagttgtctgagatccgggccgacctg
gagcggcagaaccaggagtaccaggtgctgctggacgtgaaggcccggttggagaacgag
attgccacataccggaaccttctggagagcgaggactgcaaactcccctgcaatccctgt
tccacgcctgcctcctgtacttcttgtccaagctgtggccctgtcaccggtgggtctccc
tctggccatggagccagcatggggagatga

DBGET integrated database retrieval system