KEGG   Homo sapiens (human): 8692
Entry
8692              CDS       T01001                                 

Gene name
HYAL2, LUCA2
Definition
(RefSeq) hyaluronidase 2
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00077  Chondroitin sulfate degradation
Network
nt06012  Glycosaminoglycan degradation
  Element
N00610  Dermatan sulfate degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    8692 (HYAL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    8692 (HYAL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:hsa02042]
    8692 (HYAL2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    8692 (HYAL2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    8692 (HYAL2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     8692 (HYAL2)
Bacterial toxins [BR:hsa02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   8692 (HYAL2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Enzymes
   8692 (HYAL2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  8692 (HYAL2)
SSDB
Motif
Pfam: Glyco_hydro_56 EGF
Other DBs
NCBI-GeneID: 8692
NCBI-ProteinID: NP_003764
OMIM: 603551
HGNC: 5321
Ensembl: ENSG00000068001
Vega: OTTHUMG00000156876
Pharos: Q12891(Tbio)
UniProt: Q12891
Position
3p21.31
AA seq 473 aa
MRAGPGPTVTLALVLAVSWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAF
DVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHY
IRTQESAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFE
FAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAW
LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR
RLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSW
ATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDH
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgcgggcaggcccaggccccaccgttacattggccctggtgctggcggtgtcatgggcc
atggagctcaagcccacagcaccacccatcttcactggccggccctttgtggtagcgtgg
gacgtgcccacacaggactgtggcccacgcctcaaggtgccactggacctgaatgccttt
gatgtgcaggcctcacctaatgagggttttgtgaaccagaatattaccatcttctaccgc
gaccgtctaggcctgtatccacgcttcgattctgccggaaggtctgtgcatggtggtgtg
ccacagaatgtcagcctttgggcacaccggaagatgctgcagaaacgtgtggagcactac
attcggacacaggagtctgcggggctggcggtcatcgactgggaggactggcgacctgtg
tgggtgcgcaactggcaggacaaagatgtgtatcgccggttatcacgccagctagtggcc
agtcgtcaccctgactggcctccagaccgcatagtcaaacaggcacaatatgagtttgag
ttcgcagcacagcagttcatgctggagacactgcgttatgtcaaggcagtgcggccccgg
cacctctggggcttctacctctttcctgactgctacaatcatgattatgtgcagaactgg
gagagctacacaggccgctgccctgatgttgaggtggcccgcaatgaccagctggcctgg
ctgtgggctgagagcacggccctcttcccgtctgtctacctggacgagacacttgcttcc
tcccgccatggccgcaactttgtgagcttccgtgttcaggaggcccttcgtgtggctcgc
acccaccatgccaaccatgcactcccagtctacgtcttcacacgacccacctacagccgc
aggctcacggggcttagtgagatggacctcatctctaccattggcgagagtgcggccctg
ggcgcagctggtgtcatcctctggggtgacgcggggtacaccacaagcacggagacctgc
cagtacctcaaagattacctgacacggctgctggtcccctacgtggtcaatgtgtcctgg
gccacccaatattgcagccgggcccagtgccatggccatgggcgctgtgtgcgccgcaac
cccagtgccagtaccttcctgcatctcagcaccaacagtttccgcctagtgcctggccat
gcacctggtgaaccccagctgcgacctgtgggggagctcagttgggccgacattgaccac
ctgcagacacacttccgctgccagtgctacttgggctggagtggtgagcaatgccagtgg
gaccataggcaggcagctggaggtgccagcgaggcctgggctgggtcccacctcaccagt
ctgctggctctggcagccctggcctttacctggaccttgtag

DBGET integrated database retrieval system