KEGG   Homo sapiens (human): 8697Help
Entry
8697              CDS       T01001                                 

Gene name
CDC23, ANAPC8, APC8, CUT23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  HTLV-I infection
Module
hsa_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8697 (CDC23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    8697 (CDC23)
   04114 Oocyte meiosis
    8697 (CDC23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    8697 (CDC23)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    8697 (CDC23)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     8697 (CDC23)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    8697 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 ANAPC3 TPR_16 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Motif
Other DBs
NCBI-GeneID: 8697
NCBI-ProteinID: NP_004652
OMIM: 603462
HGNC: 1724
Ensembl: ENSG00000094880
Vega: OTTHUMG00000129198
Pharos: Q9UJX2(Tbio)
UniProt: Q9UJX2
Structure
PDB: 

Position
5q31.2
AA seq 597 aa AA seqDB search
MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagtacctccatggtcccggtggctgtgacggcggcagtggcgcctgtcctg
tccataaacagcgatttctcagatttgcgggaaattaaaaagcaactgctgcttattgcg
ggccttacccgggagcggggcctactacacagtagcaaatggtcggcggagttggctttc
tctctccctgcattgcctctggccgagctgcaaccgcctccgcctattacagaggaagat
gcccaggatatggatgcctataccctggccaaggcctactttgacgttaaagagtatgat
cgggcagcacatttcctgcatggctgcaatagcaagaaagcctattttctgtatatgtat
tccagatatctgtctggagaaaaaaagaaggacgatgaaacagttgatagcttaggcccc
ctggaaaaaggacaagtgaaaaatgaggcgcttagagaattgagagtggagctcagcaaa
aaacaccaagctcgagaacttgatggatttggactttatctgtatggtgtggtgcttcga
aaactggacttggttaaagaggccattgatgtgtttgtggaagctactcatgttttgccc
ttgcattggggagcctggttagaactctgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcgtatattgtttcccaaattgcagttgcctatcacaatatcagagatattgac
aaagccctctccatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacacattctccaaccttctttatgtcaggagcatgaaatcggagttgagttatctggct
cataacctctgtgagattgataaatatcgtgtagaaacgtgctgtgtaattggcaattat
tacagtttacgttctcagcatgagaaagcagccttatatttccagagagccctgaaatta
aatcctcggtatcttggtgcctggacactaatgggacatgagtacatggagatgaagaac
acgtctgctgctatccaggcttatagacatgccattgaggtcaacaaacgggactacaga
gcttggtatggcctcgggcagacctatgaaatccttaagatgccattttactgcctttat
tattatagacgggcccaccagcttcgacccaatgattctcgcatgctggttgctttagga
gaatgttacgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcttac
gccgtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggctgcccagtgttacatcaaatatatccaagatatctattcctgt
ggggaaatagtagaacacttggaggaaagcactgcctttcgctatctggcccagtactat
tttaagtgcaaactgtgggatgaagcttcaacttgtgcacaaaagtgttgtgcatttaat
gatacccgggaagaaggtaaggccttactccggcaaatcctacagcttcggaaccaaggc
gagactcctaccaccgaggtgcctgctccctttttcctacctgcttcactctctgctaac
aatacccccacacgcagagtttctccactcaacttgtcttctgtcacgccatag

DBGET integrated database retrieval system