KEGG   Homo sapiens (human): 8697
Entry
8697              CDS       T01001                                 

Gene name
CDC23, ANAPC8, APC8, CUT23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8697 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    8697 (CDC23)
   04114 Oocyte meiosis
    8697 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    8697 (CDC23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    8697 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8697 (CDC23)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8697 (CDC23)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     8697 (CDC23)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    8697 (CDC23)
SSDB
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_16 ANAPC3 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Other DBs
NCBI-GeneID: 8697
NCBI-ProteinID: NP_004652
OMIM: 603462
HGNC: 1724
Ensembl: ENSG00000094880
Vega: OTTHUMG00000129198
Pharos: Q9UJX2(Tbio)
UniProt: Q9UJX2
Structure
PDB: 

Position
5q31.2
AA seq 597 aa
MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggctgcgagtacctccatggtcccggtggctgtgacggcggcagtggcgcctgtcctg
tccataaacagcgatttctcagatttgcgggaaattaaaaagcaactgctgcttattgcg
ggccttacccgggagcggggcctactacacagtagcaaatggtcggcggagttggctttc
tctctccctgcattgcctctggccgagctgcaaccgcctccgcctattacagaggaagat
gcccaggatatggatgcctataccctggccaaggcctactttgacgttaaagagtatgat
cgggcagcacatttcctgcatggctgcaatagcaagaaagcctattttctgtatatgtat
tccagatatctgtctggagaaaaaaagaaggacgatgaaacagttgatagcttaggcccc
ctggaaaaaggacaagtgaaaaatgaggcgcttagagaattgagagtggagctcagcaaa
aaacaccaagctcgagaacttgatggatttggactttatctgtatggtgtggtgcttcga
aaactggacttggttaaagaggccattgatgtgtttgtggaagctactcatgttttgccc
ttgcattggggagcctggttagaactctgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcgtatattgtttcccaaattgcagttgcctatcacaatatcagagatattgac
aaagccctctccatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacacattctccaaccttctttatgtcaggagcatgaaatcggagttgagttatctggct
cataacctctgtgagattgataaatatcgtgtagaaacgtgctgtgtaattggcaattat
tacagtttacgttctcagcatgagaaagcagccttatatttccagagagccctgaaatta
aatcctcggtatcttggtgcctggacactaatgggacatgagtacatggagatgaagaac
acgtctgctgctatccaggcttatagacatgccattgaggtcaacaaacgggactacaga
gcttggtatggcctcgggcagacctatgaaatccttaagatgccattttactgcctttat
tattatagacgggcccaccagcttcgacccaatgattctcgcatgctggttgctttagga
gaatgttacgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcttac
gccgtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggctgcccagtgttacatcaaatatatccaagatatctattcctgt
ggggaaatagtagaacacttggaggaaagcactgcctttcgctatctggcccagtactat
tttaagtgcaaactgtgggatgaagcttcaacttgtgcacaaaagtgttgtgcatttaat
gatacccgggaagaaggtaaggccttactccggcaaatcctacagcttcggaaccaaggc
gagactcctaccaccgaggtgcctgctccctttttcctacctgcttcactctctgctaac
aatacccccacacgcagagtttctccactcaacttgtcttctgtcacgccatag

DBGET integrated database retrieval system