KEGG   Homo sapiens (human): 8698Help
Entry
8698              CDS       T01001                                 

Gene name
S1PR4, EDG6, LPC1, S1P4, SLP4
Definition
(RefSeq) sphingosine-1-phosphate receptor 4
  KO
K04293  sphingosine 1-phosphate receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Amiselimod (DG02399): D10904 D10905
Etrasimod (DG02444): D10930
Ozanimod (DG02827): D10967 D10968
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    8698 (S1PR4)
   04071 Sphingolipid signaling pathway
    8698 (S1PR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8698 (S1PR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8698 (S1PR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    8698 (S1PR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 8698
NCBI-ProteinID: NP_003766
OMIM: 603751
HGNC: 3170
Ensembl: ENSG00000125910
Vega: OTTHUMG00000180672
Pharos: O95977(Tclin)
UniProt: O95977
Position
19p13.3
AA seq 384 aa AA seqDB search
MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccacggggaccccggtggcccccgagtcctgccaacagctggcggccggcggg
cacagccggctcattgttctgcactacaaccactcgggccggctggccgggcgcgggggg
ccggaggatggcggcctgggggccctgcgggggctgtcggtggccgccagctgcctggtg
gtgctggagaacttgctggtgctggcggccatcaccagccacatgcggtcgcgacgctgg
gtctactattgcctggtgaacatcacgctgagtgacctgctcacgggcgcggcctacctg
gccaacgtgctgctgtcgggggcccgcaccttccgtctggcgcccgcccagtggttccta
cgggagggcctgctcttcaccgccctggccgcctccaccttcagcctgctcttcactgca
ggggagcgctttgccaccatggtgcggccggtggccgagagcggggccaccaagaccagc
cgcgtctacggcttcatcggcctctgctggctgctggccgcgctgctggggatgctgcct
ttgctgggctggaactgcctgtgcgcctttgaccgctgctccagccttctgcccctctac
tccaagcgctacatcctcttctgcctggtgatcttcgccggcgtcctggccaccatcatg
ggcctctatggggccatcttccgcctggtgcaggccagcgggcagaaggccccacgccca
gcggcccgccgcaaggcccgccgcctgctgaagacggtgctgatgatcctgctggccttc
ctggtgtgctggggcccactcttcgggctgctgctggccgacgtctttggctccaacctc
tgggcccaggagtacctgcggggcatggactggatcctggccctggccgtcctcaactcg
gcggtcaaccccatcatctactccttccgcagcagggaggtgtgcagagccgtgctcagc
ttcctctgctgcgggtgtctccggctgggcatgcgagggcccggggactgcctggcccgg
gccgtcgaggctcactccggagcttccaccaccgacagctctctgaggccaagggacagc
tttcgcggctcccgctcgctcagctttcggatgcgggagcccctgtccagcatctccagc
gtgcggagcatctga

DBGET integrated database retrieval system