KEGG   Homo sapiens (human): 8702
Entry
8702              CDS       T01001                                 
Symbol
B4GALT4, B4Gal-T4, beta4Gal-T4
Name
(RefSeq) beta-1,4-galactosyltransferase 4
  KO
K07969  beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.275 2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00533  Glycosaminoglycan biosynthesis - keratan sulfate
hsa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
hsa01100  Metabolic pathways
Module
hsa_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    8702 (B4GALT4)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    8702 (B4GALT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    8702 (B4GALT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     8702 (B4GALT4)
    2.4.1.275  neolactotriaosylceramide beta-1,4-galactosyltransferase
     8702 (B4GALT4)
    2.4.1.-
     8702 (B4GALT4)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   8702 (B4GALT4)
SSDB
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C PsbY
Other DBs
NCBI-GeneID: 8702
NCBI-ProteinID: NP_003769
OMIM: 604015
HGNC: 927
Ensembl: ENSG00000121578
Pharos: O60513(Tdark)
UniProt: O60513 B2RAZ5 B3KM35
Position
3:complement(119211742..119240878)
AA seq 344 aa
MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKG
KTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKA
LQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLE
ALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSR
EQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAE
RMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgggcttcaacctgactttccacctttcctacaaattccgattactgttgctgttgact
ttgtgcctgacagtggttgggtgggccaccagtaactacttcgtgggtgccattcaagag
attcctaaagcaaaggagttcatggctaatttccataagaccctcattttggggaaggga
aaaactctgactaatgaagcatccacgaagaaggtagaacttgacaactgcccttctgtg
tctccttacctcagaggccagagcaagctcattttcaaaccagatctcactttggaagag
gtacaggcagaaaatcccaaagtgtccagaggccggtatcgccctcaggaatgtaaagct
ttacagagggtcgccatcctcgttccccaccggaacagagagaaacacctgatgtacctg
ctggaacatctgcatcccttcctgcagaggcagcagctggattatggcatctacgtcatc
caccaggctgaaggtaaaaagtttaatcgagccaaactcttgaatgtgggctatctagaa
gccctcaaggaagaaaattgggactgctttatattccacgatgtggacctggtacccgag
aatgactttaacctttacaagtgtgaggagcatcccaagcatctggtggttggcaggaac
agcactgggtacaggttacgttacagtggatattttgggggtgttactgccctaagcaga
gagcagtttttcaaggtgaatggattctctaacaactactggggatggggaggcgaagac
gatgacctcagactcagggttgagctccaaagaatgaaaatttcccggcccctgcctgaa
gtgggtaaatatacaatggtcttccacactagagacaaaggcaatgaggtgaacgcagaa
cggatgaagctcttacaccaagtgtcacgagtctggagaacagatgggttgagtagttgt
tcttataaattagtatctgtggaacacaatcctttatatatcaacatcacagtggatttc
tggtttggtgcatga

DBGET integrated database retrieval system