KEGG   Homo sapiens (human): 8705
Entry
8705              CDS       T01001                                 

Gene name
B3GALT4, BETA3GALT4, GALT2, GALT4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00604  Glycosphingolipid biosynthesis - ganglio series
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    8705 (B3GALT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    8705 (B3GALT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     8705 (B3GALT4)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Glycolipid
   8705 (B3GALT4)
SSDB
Motif
Pfam: Galactosyl_T
Other DBs
NCBI-GeneID: 8705
NCBI-ProteinID: NP_003773
OMIM: 603095
HGNC: 919
Ensembl: ENSG00000235863
Vega: OTTHUMG00000031100
Pharos: O96024(Tbio)
UniProt: O96024 Q5STJ7 B3KQP5
Position
6p21.32
AA seq 378 aa
MQLRLFRRLLLAALLLVIVWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPN
QEACSGPGAPPFLLILVCTAPENLNQRNAIRASWGGLREARGLRVQTLFLLGEPNAQHPV
WGSQGSDLASESAAQGDILQAAFQDSYRNLTLKTLSGLNWAEKHCPMARYVLKTDDDVYV
NVPELVSELVLRGGRWGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNPSRTP
GGRHRVSEEQWPHTWGPFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARR
GGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSW
FQGVLGILRCRAIAWLQS
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgcagctcaggctcttccggcgcctccttctcgccgctttgctgctggtgatcgtctgg
accctcttcgggccttcggggttgggggaggagctgctgagcctctcactagcctccctg
ctcccagcccccgcctcaccggggccgcccctggccctgccccgcctcttgatccccaac
caggaagcttgcagtggtcccggggcccctcccttcctgctcatcctggtgtgcacggct
ccggagaacctgaaccagagaaacgccattcgggcttcgtggggcgggctgcgcgaggcc
cgggggctcagggtacagacgctattcttgctgggagagccgaacgcacagcaccccgtg
tggggttcccaggggagtgacctggcctcggagtcagcagcccagggggatatcttgcag
gccgccttccaggactcctaccgcaacctcaccctaaagaccctcagcgggctgaactgg
gctgagaaacactgccccatggcccgatacgtcctcaagacggacgatgatgtgtatgtc
aacgtccctgaactggtatcagagctggtcttgcgagggggccgttgggggcaatgggag
agaagcacggaaccccagagagaggctgagcaggaaggaggccaggttttgcacagcgag
gaagtgcctcttctgtacttgggccgggtgcactggcgcgtgaacccctctcggacaccg
gggggcaggcaccgcgtatcagaggagcagtggcctcacacctggggcccctttccaccc
tatgcctcaggcacggggtatgtgctgtcagcgtctgctgtgcagctcattctcaaggtg
gccagccgggcaccccttctcccattagaggatgtctttgtgggggtaagtgcccgacga
ggaggcctcgccccaacacagtgtgtcaagctggctggtgccacccactacccgctagac
cggtgctgctatgggaaattcctgctgacgtcccacaggctggacccctggaagatgcag
gaagcctggaagctggtgggtggctctgacggggaaaggactgcgcccttttgctcctgg
ttccagggagtcctgggcatcctgcggtgtcgagcaatagcctggcttcagagctga

DBGET integrated database retrieval system