KEGG   Homo sapiens (human): 8710Help
Entry
8710              CDS       T01001                                 

Gene name
SERPINB7, MEGSIN, PPKN, TP55
Definition
(RefSeq) serpin family B member 7
  KO
K13964  serpin B7
Organism
hsa  Homo sapiens (human)
Disease
H02264  Palmoplantar keratoderma, Nagashima type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    8710 (SERPINB7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 8710
NCBI-ProteinID: NP_001035237
OMIM: 603357
HGNC: 13902
Ensembl: ENSG00000166396
Vega: OTTHUMG00000060591
Pharos: O75635(Tbio)
UniProt: O75635
Position
18q21.33
AA seq 380 aa AA seqDB search
MASLAAANAEFCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHV
NTASGYGNSSNSQSGLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEK
LYDAKVERVDFTNHLEDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGK
WQSAFTKSETINCHFKSPKCSGKAVAMMHQERKFNLSVIEDPSMKILELRYNGGINMYVL
LPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIF
DESKADLSGIASGGRLYISRMMHKSYIEVTEEGTEATAATGSNIVEKQLPQSTLFRADHP
FLFVIRKDDIILFSGKVSCP
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccttgctgcagcaaatgcagagttttgcttcaacctgttcagagagatggat
gacaatcaaggaaatggaaatgtgttcttttcctctctgagcctcttcgctgccctggcc
ctggtccgcttgggcgctcaagatgactccctctctcagattgataagttgcttcatgtt
aacactgcctcaggatatggaaactcttctaatagtcagtcagggctccagtctcaactg
aaaagagttttttctgatataaatgcatcccacaaggattatgatctcagcattgtgaat
gggctttttgctgaaaaagtgtatggctttcataaggactacattgagtgtgccgaaaaa
ttatacgatgccaaagtggagcgagttgactttacgaatcatttagaagacactagacgt
aatattaataagtgggttgaaaatgaaacacatggcaaaatcaagaacgtgattggtgaa
ggtggcataagctcatctgctgtaatggtgctggtgaatgctgtgtacttcaaaggcaag
tggcaatcagccttcaccaagagcgaaaccataaattgccatttcaaatctcccaagtgc
tctgggaaggcagtcgccatgatgcatcaggaacggaagttcaatttgtctgttattgag
gacccatcaatgaagattcttgagctcagatacaatggtggcataaacatgtacgttctg
ctgcctgagaatgacctctctgaaattgaaaacaaactgacctttcagaatctaatggaa
tggaccaatccaaggcgaatgacctctaagtatgttgaggtattttttcctcagttcaag
atagagaagaattatgaaatgaaacaatatttgagagccctagggctgaaagatatcttt
gatgaatccaaagcagatctctctgggattgcttcggggggtcgtctgtatatatcaagg
atgatgcacaaatcttacatagaggtcactgaggagggcaccgaggctactgctgccaca
ggaagtaatattgtagaaaagcaactccctcagtccacgctgtttagagctgaccaccca
ttcctatttgttatcaggaaggatgacatcatcttattcagtggcaaagtttcttgccct
tga

DBGET integrated database retrieval system