KEGG   Homo sapiens (human): 8711Help
Entry
8711              CDS       T01001                                 

Gene name
TNK1
Definition
(RefSeq) tyrosine kinase non receptor 1
  KO
K08885  non-receptor tyrosine-protein kinase TNK1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8711 (TNK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     8711 (TNK1)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  ACK family
   8711 (TNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH3_2 SH3_9 APH HOIP-UBA Kinase-like
Motif
Other DBs
NCBI-GeneID: 8711
NCBI-ProteinID: NP_001238831
OMIM: 608076
HGNC: 11940
Ensembl: ENSG00000174292
Vega: OTTHUMG00000178174
Pharos: Q13470(Tchem)
UniProt: Q13470
Position
17p13.1
AA seq 666 aa AA seqDB search
MLPEAGSLWLLKLLRDIQLAQFYWPILEELNVTRPEHFDFVKPEDLDGIGMGRPAQRRLS
EALKRLRSGPKSKNWVYKILGGFAPEHKEPTLPSDSPRHLPEPEGGLKCLIPEGAVCRGE
LLGSGCFGVVHRGLWTLPSGKSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPHV
LRLHGLVLGQPLQMVMELAPLGSLHARLTAPAPTPPLLVALLCLFLRQLAGAMAYLGARG
LVHRDLATRNLLLASPRTIKVADFGLVRPLGGARGRYVMGGPRPIPYAWCAPESLRHGAF
SSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEDRARLPRPPLCSRALYSLALRCW
APHPADRPSFSHLEGLLQEAGPSEACCVRDVTEPGALRMETGDPITVIEGSSSFHSPDST
IWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWD
APPARGQRRNMPLERMKGISRSLESVLSLGPRPTGGGSSPPEIRQARAVPQGPPGLPPRP
PLSSSSPQPSQPSRERLPWPKRKPPHNHPMGMPGARKAAALSGGLLSDPELQRKIMEVEL
SVHGVTHQECQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADCWRILEHYQWDLSAASR
YVLARP
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctgaggctggctccctgtggctactgaagctgctccgggacatccagttggcc
cagttttactggcccatccttgaggagcttaatgtcactcggccagagcacttcgacttt
gtaaagcctgaggacctggacggcattggcatgggccggcctgcccagcgcagactgtcc
gaagctctgaaaaggctacgttctgggcctaagtctaagaactgggtctacaagatcctt
ggaggttttgcccctgagcacaaggagcccaccctgccctcggacagcccacggcacctc
cctgagccagaggggggcctcaagtgtctgatcccagagggtgctgtttgcagaggggag
ctgctgggttcaggctgcttcggtgtggtgcaccgagggctgtggacgctgcccagtggc
aagagtgtcccagtggctgtcaagtccctccgggtaggtcccgaaggcccgatgggcaca
gaactgggggacttcctgcgagaggtatcggtcatgatgaacttggagcacccacacgtg
ctgcgtctgcacggccttgtactgggccagcctctgcagatggtgatggagctggcgcca
ctgggctccctgcacgcgcgcctaacggccccggccccgacacccccgctgctcgtggcc
ctgctctgcctcttcctgcggcagctggcgggagccatggcgtacctgggggcccgcggg
ctggtgcaccgagacctcgctacgcgcaacctactgctggcgtcgccgcgcaccatcaag
gtggctgacttcgggctggtgcggcctctgggcggtgcccggggccgctacgtcatgggc
gggccccgccctatcccctacgcctggtgtgccccagagagcctgcgccacggagccttc
tcgtctgcctcggacgtgtggatgtttggggtgacgctgtgggagatgttctccgggggc
gaggaaccctgggccggggtcccaccgtacctcatcctgcagcggctggaggacagagcc
cggctgcctaggcctcccctctgctccagggccctctactccctcgccttgcgctgctgg
gccccccaccctgccgaccggcctagcttttcccacctggaggggctgctgcaagaggcc
gggccttcggaagcatgttgtgtgagggatgtcacagaaccaggcgccctgaggatggag
actggtgaccccatcacagtcatcgagggcagctcctctttccacagccccgactccaca
atctggaagggccagaatggtcgcaccttcaaagtgggcagcttcccagcctcggcagtg
acgctggcagatgcggggggcttgccagccacccgtccagtccacagaggcacccctgcc
cggggagatcaacacccaggaagcatagatggagacagaaagaaggcaaatctttgggat
gcgcccccagcacggggccagaggaggaacatgcccctggagaggatgaaaggcatttcc
aggagtctggagtcagttctgtccctcggtcctcgtcccacagggggtggttcaagcccc
cctgaaattcgacaagccagagctgtgccccagggacctccaggcctgcctccacgccca
cctttatcctctagctctcctcagcccagccagccctctagggagaggcttccctggccc
aaaagaaaacccccacacaatcaccccatgggaatgcctggagcccgtaaagccgctgcc
ctctctggaggcctcttgtccgatcctgagttgcagaggaagattatggaggtggagctg
agtgtgcatggggtcacccaccaggagtgccagacagcactaggagccactgggggagat
gtggtttctgccatccggaacctcaaggtagatcagctcttccacctgagtagccggtcc
agagctgactgctggcgcatcctggagcattaccagtgggacctctcagctgccagccgc
tatgtcctggccaggccctga

DBGET integrated database retrieval system