KEGG   Homo sapiens (human): 8717Help
Entry
8717              CDS       T01001                                 

Gene name
TRADD, Hs.89862
Definition
(RefSeq) TNFRSF1A associated via death domain
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
Network
N00145  Extrinsic apoptotic pathway
N00151  TNF-NFKB signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00273  HCV NS5A to host-cell-protein inhibition
N00350  HPV E6 to extrinsic apoptotic pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    8717 (TRADD)
   04064 NF-kappa B signaling pathway
    8717 (TRADD)
   04668 TNF signaling pathway
    8717 (TRADD)
   04071 Sphingolipid signaling pathway
    8717 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    8717 (TRADD)
   04217 Necroptosis
    8717 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    8717 (TRADD)
   04657 IL-17 signaling pathway
    8717 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    8717 (TRADD)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    8717 (TRADD)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    8717 (TRADD)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    8717 (TRADD)
   05160 Hepatitis C
    8717 (TRADD)
   05163 Human cytomegalovirus infection
    8717 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    8717 (TRADD)
   05169 Epstein-Barr virus infection
    8717 (TRADD)
   05165 Human papillomavirus infection
    8717 (TRADD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRADD_N Death
Motif
Other DBs
NCBI-GeneID: 8717
NCBI-ProteinID: NP_001310481
OMIM: 603500
HGNC: 12030
Ensembl: ENSG00000102871
Vega: OTTHUMG00000137519
Pharos: Q15628(Tbio)
UniProt: Q15628
Structure
PDB: 

Position
16q22.1
AA seq 312 aa AA seqDB search
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
QPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRG
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTDPNGGLA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgggcaaaatgggcacgaagagtgggtgggcagcgcatacctgtttgtggag
tcctcgctggacaaggtggtcctgtcggatgcctacgcgcacccccagcagaaggtggca
gtgtacagggctctgcaggctgccttggcagagagcggcgggagcccggacgtgctgcag
atgctgaagatccaccgcagcgacccgcagctgatcgtgcagctgcgattctgcgggcgg
cagccctgtggccgcttcctccgcgcctaccgcgagggggcgctgcgcgccgcgctgcag
aggagcctggcggccgcgctcgcccagcactcggtgccgctgcaactggagctgcgcgcc
ggcgccgagcggctggacgctttgctggcggacgaggagcgctgtttgagttgcatccta
gcccagcagcccgaccggctccgggatgaagaactggctgagctggaggatgcgctgcga
aatctgaagtgcggctcgggggcccggggtggcgacggggaggtcgcttcggcccccttg
cagcccccggtgccctctctgtcggaggtgaagccgccgccgccgccgccacctgcccag
acttttctgttccagggtcagcctgtagtgaatcggccgctgagcctgaaggaccaacag
acgttcgcgcgctctgtgggtctcaaatggcgcaaggtggggcgctcactgcagcgaggc
tgccgggcgctgcgggacccggcgctggactcgctggcctacgagtacgagcgcgaggga
ctgtacgagcaggccttccagctgctgcggcgcttcgtgcaggccgagggccgccgcgcc
acgctgcagcgcctggtggaggcactcgaggagaacgagctcaccagcctggcagaggac
ttgctgggcctgaccgatcccaatggcggcctggcctag

DBGET integrated database retrieval system