KEGG   Homo sapiens (human): 8717
Entry
8717              CDS       T01001                                 

Gene name
TRADD, Hs.89862
Definition
(RefSeq) TNFRSF1A associated via death domain
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06123  TNF signaling (viruses and bacteria)
nt06131  Apoptosis (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06223  TNF signaling
nt06231  Apoptosis
nt06263  Hepatocellular carcinoma
nt06414  Apoptosis
nt06416  TNF signaling
nt06461  Huntington disease
  Element
N00145  Extrinsic apoptotic pathway
N00151  TNF-NFKB signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00524  HCV NS5A to extrinsic apoptotic pathway
N00525  HCV NS5A to TNF-NFKB signaling pathway
N01113  Salmonella SseK1 to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    8717 (TRADD)
   04064 NF-kappa B signaling pathway
    8717 (TRADD)
   04668 TNF signaling pathway
    8717 (TRADD)
   04071 Sphingolipid signaling pathway
    8717 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    8717 (TRADD)
   04217 Necroptosis
    8717 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    8717 (TRADD)
   04657 IL-17 signaling pathway
    8717 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    8717 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8717 (TRADD)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    8717 (TRADD)
   05132 Salmonella infection
    8717 (TRADD)
   05131 Shigellosis
    8717 (TRADD)
   05152 Tuberculosis
    8717 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8717 (TRADD)
   05162 Measles
    8717 (TRADD)
   05164 Influenza A
    8717 (TRADD)
   05160 Hepatitis C
    8717 (TRADD)
   05168 Herpes simplex virus 1 infection
    8717 (TRADD)
   05163 Human cytomegalovirus infection
    8717 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    8717 (TRADD)
   05169 Epstein-Barr virus infection
    8717 (TRADD)
   05165 Human papillomavirus infection
    8717 (TRADD)
SSDB
Motif
Pfam: TRADD_N Death CARD_2
Other DBs
NCBI-GeneID: 8717
NCBI-ProteinID: NP_001310481
OMIM: 603500
HGNC: 12030
Ensembl: ENSG00000102871
Vega: OTTHUMG00000137519
Pharos: Q15628(Tbio)
UniProt: Q15628
Structure
PDB: 
6AC0 1F3V 5XME 1F2H

Position
16q22.1
AA seq 312 aa
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
QPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRG
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTDPNGGLA
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcagctgggcaaaatgggcacgaagagtgggtgggcagcgcatacctgtttgtggag
tcctcgctggacaaggtggtcctgtcggatgcctacgcgcacccccagcagaaggtggca
gtgtacagggctctgcaggctgccttggcagagagcggcgggagcccggacgtgctgcag
atgctgaagatccaccgcagcgacccgcagctgatcgtgcagctgcgattctgcgggcgg
cagccctgtggccgcttcctccgcgcctaccgcgagggggcgctgcgcgccgcgctgcag
aggagcctggcggccgcgctcgcccagcactcggtgccgctgcaactggagctgcgcgcc
ggcgccgagcggctggacgctttgctggcggacgaggagcgctgtttgagttgcatccta
gcccagcagcccgaccggctccgggatgaagaactggctgagctggaggatgcgctgcga
aatctgaagtgcggctcgggggcccggggtggcgacggggaggtcgcttcggcccccttg
cagcccccggtgccctctctgtcggaggtgaagccgccgccgccgccgccacctgcccag
acttttctgttccagggtcagcctgtagtgaatcggccgctgagcctgaaggaccaacag
acgttcgcgcgctctgtgggtctcaaatggcgcaaggtggggcgctcactgcagcgaggc
tgccgggcgctgcgggacccggcgctggactcgctggcctacgagtacgagcgcgaggga
ctgtacgagcaggccttccagctgctgcggcgcttcgtgcaggccgagggccgccgcgcc
acgctgcagcgcctggtggaggcactcgaggagaacgagctcaccagcctggcagaggac
ttgctgggcctgaccgatcccaatggcggcctggcctag

DBGET integrated database retrieval system