KEGG   Homo sapiens (human): 8718Help
Entry
8718              CDS       T01001                                 

Gene name
TNFRSF25, APO-3, DDR3, DR3, LARD, TNFRSF12, TR3, TRAMP, WSL-1, WSL-LR
Definition
(RefSeq) TNF receptor superfamily member 25
  KO
K05160  tumor necrosis factor receptor superfamily member 25
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8718 (TNFRSF25)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   8718 (TNFRSF25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TNFR_c6 NrfD
Motif
Other DBs
NCBI-GeneID: 8718
NCBI-ProteinID: NP_003781
OMIM: 603366
HGNC: 11910
Ensembl: ENSG00000215788
Vega: OTTHUMG00000000831
Pharos: Q93038(Tbio)
UniProt: Q93038
Position
1p36.31
AA seq 417 aa AA seqDB search
MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAP
CTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPG
WFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCP
TSTLGSCPERCAAVCGWRQMFWVQVLLAGLVVPLLLGATLTYTYRHCWPHKPLVTADEAG
MEALTPPPATHLSPLDSAHTLLAPPDSSEKICTVQLVGNSWTPGYPETQEALCPQVTWSW
DQLPSRALGPAAAPTLSPESPAGSPAMMLQPGPQLYDVMDAVPARRWKEFVRTLGLREAE
IEAVEVEIGRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcggccgcggggctgcgcggcggtggcggcggcgctcctcctggtgctgctg
ggggcccgggcccagggcggcactcgtagccccaggtgtgactgtgccggtgacttccac
aagaagattggtctgttttgttgcagaggctgcccagcggggcactacctgaaggcccct
tgcacggagccctgcggcaactccacctgccttgtgtgtccccaagacaccttcttggcc
tgggagaaccaccataattctgaatgtgcccgctgccaggcctgtgatgagcaggcctcc
caggtggcgctggagaactgttcagcagtggccgacacccgctgtggctgtaagccaggc
tggtttgtggagtgccaggtcagccaatgtgtcagcagttcacccttctactgccaacca
tgcctagactgcggggccctgcaccgccacacacggctactctgttcccgcagagatact
gactgtgggacctgcctgcctggcttctatgaacatggcgatggctgcgtgtcctgcccc
acgagcaccctggggagctgtccagagcgctgtgccgctgtctgtggctggaggcagatg
ttctgggtccaggtgctcctggctggccttgtggtccccctcctgcttggggccaccctg
acctacacataccgccactgctggcctcacaagcccctggttactgcagatgaagctggg
atggaggctctgaccccaccaccggccacccatctgtcacccttggacagcgcccacacc
cttctagcacctcctgacagcagtgagaagatctgcaccgtccagttggtgggtaacagc
tggacccctggctaccccgagacccaggaggcgctctgcccgcaggtgacatggtcctgg
gaccagttgcccagcagagctcttggccccgctgctgcgcccacactctcgccagagtcc
ccagccggctcgccagccatgatgctgcagccgggcccgcagctctacgacgtgatggac
gcggtcccagcgcggcgctggaaggagttcgtgcgcacgctggggctgcgcgaggcagag
atcgaagccgtggaggtggagatcggccgcttccgagaccagcagtacgagatgctcaag
cgctggcgccagcagcagcccgcgggcctcggagccgtttacgcggccctggagcgcatg
gggctggacggctgcgtggaagacttgcgcagccgcctgcagcgcggcccgtga

DBGET integrated database retrieval system