KEGG   Homo sapiens (human): 8725Help
Entry
8725              CDS       T01001                                 

Gene name
URI1, C19orf2, NNX3, PPP1R19, RMP, URI
Definition
(RefSeq) URI1, prefoldin like chaperone
  KO
K17560  unconventional prefoldin RPB5 interactor 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8725 (URI1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     8725 (URI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prefoldin Prefoldin_3 Nmad5 DUF3835
Motif
Other DBs
NCBI-GeneID: 8725
NCBI-ProteinID: NP_003787
OMIM: 603494
HGNC: 13236
Ensembl: ENSG00000105176
Vega: OTTHUMG00000177923
Pharos: O94763(Tbio)
UniProt: O94763
Position
19q12
AA seq 535 aa AA seqDB search
MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNA
LRERLSTLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHR
KEHVRKTIDDLKKVMKNFESRVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHK
PHSKPKTSDIFEADIANDVKSKDLLADKELWARLEELERQEELLGELDSKPDTVIANGED
TTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSGQVNSQLNCSVNGSSSYHSDD
DDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINTGKNTTLKFSE
KKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVC
SDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGT
VIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcccaccgtggagacgccccccgacccctcgcccccttcggccccggcccct
gccctggttccgttgcgcgccccggatgtggcgcggctgcgcgaggagcaggaaaaggtg
gtcactaactgccaagagagaatccagcattggaagaaggtagataatgactataatgcc
cttcgagaaagactcagcaccttgcctgataaattgtcttataatataatggtaccattt
ggcccttttgccttcatgccaggaaaacttgtccatactaatgaagtcactgttttactg
ggggacaactggtttgcaaagtgctcagcaaagcaggctgtaggtttagttgagcaccgg
aaagaacatgtaagaaaaacaatagatgacttaaaaaaagtgatgaaaaattttgaatcc
agagttgaattcacagaagatttgcagaaaatgagcgatgctgcaggtgatattgttgac
atacgagaagaaattaaatgtgacttcgaatttaaagcaaaacaccgaattgctcataaa
ccgcattccaaaccaaaaacttcagatatttttgaagcagatattgcaaatgatgtgaaa
tccaaggatttgctagctgataaagaactgtgggctcgacttgaagaactagagagacag
gaagaattgctgggtgaacttgatagtaagcctgatactgtgattgcaaatggagaagat
acgacatcttctgaagaggaaaaggaagatcgtaacacaaatgtgaatgcgatgcatcaa
gtaacagactctcatactccttgtcataaggatgttgcaagttcagaaccattcagtggt
caagtgaatagtcagttgaactgttcagtgaatggttccagttcttaccacagtgatgat
gatgatgatgatgatgatgacgacgacgacgacaacattgacgacgatgatggtgataac
gaccatgaggctttaggggttggagataattctataccaacaatatatttttcacatact
gttgagcctaagagggtccgaataaatactggaaagaataccactttaaaattcagtgaa
aagaaagaagaagccaaacgtaaacgaaagaacagcactggcagtggccactctgcccag
gagctgccgaccatcaggacgcctgcagacatttacagagcctttgttgatgttgtgaat
ggagaatatgtccctcgcaaatccatcctgaagtctcgaagtagagagaatagtgtgtgt
agcgacactagtgaaagcagtgctgctgaatttgatgataggcggggagttttgaggagt
atcagctgcgaagaagccacttgcagtgacaccagtgagagcattttggaagaggaacca
caagaaaatcaaaagaaacttttgcccttatcagtaacacctgaggctttttctggaact
gttatagaaaaagaatttgtatcaccttccttaacaccacccccagccattgctcatccc
gcactacccactattccagaacgaaaggaagttctgttggaagcatctgaagaaactgga
aagagggtttcaaagtttaaagctgccagattgcaacagaaagactag

DBGET integrated database retrieval system