KEGG   Homo sapiens (human): 8726Help
Entry
8726              CDS       T01001                                 

Gene name
EED, COGIS, HEED, WAIT1
Definition
(RefSeq) embryonic ectoderm development
  KO
K11462  polycomb protein EED
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8726 (EED)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC2-EZH1 complex
     8726 (EED)
    PRC2-EZH2 complex
     8726 (EED)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 8726
NCBI-ProteinID: NP_003788
OMIM: 605984
HGNC: 3188
Ensembl: ENSG00000074266
Vega: OTTHUMG00000167209
Pharos: O75530(Tbio)
UniProt: O75530
Structure
PDB: 

Position
11q14.2
AA seq 441 aa AA seqDB search
MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTP
NAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNR
VTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITM
QCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVL
SADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFS
TRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQ
CDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR
DSSILIAVCDDASIWRWDRLR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagagggaagtgtcgactgcgccggcgggaacagacatgcctgcggccaagaag
cagaagctgagcagtgacgagaacagcaatccagacctctctggagacgagaatgatgac
gctgtcagtatagaaagtggtacaaacactgaacgccctgatacacctacaaacacgcca
aatgcacctggaaggaaaagttggggaaagggaaaatggaagtcaaagaaatgcaaatat
tctttcaaatgtgtaaatagtctcaaggaagatcataaccaaccattgtttggagttcag
tttaactggcacagtaaagaaggagatccattagtgtttgcaactgtaggaagcaacaga
gttaccttgtatgaatgtcattcacaaggagaaatccggttgttgcaatcttacgtggat
gctgatgctgatgaaaacttttacacttgtgcatggacctatgatagcaatacgagccat
cctctgctggctgtagctggatctagaggcataattaggataataaatcctataacaatg
cagtgtataaagcactatgttggccatggaaatgctatcaatgagctgaaattccatcca
agagatccaaatcttctcctgtcagtaagtaaagatcatgctttacgattatggaatatc
cagacggacactctggtggcaatatttggaggcgtagaagggcacagagatgaagttcta
agtgctgattatgatcttttgggtgaaaaaataatgtcctgtggtatggatcattctctt
aaactttggaggatcaattcaaagagaatgatgaatgcaattaaggaatcttatgattat
aatccaaataaaactaacaggccatttatttctcagaaaatccattttcctgatttttct
accagagacatacataggaattatgttgattgtgtgcgatggttaggcgatttgatactt
tctaagtcttgtgaaaatgccattgtgtgctggaaacctggcaagatggaagatgatata
gataaaattaaacccagtgaatctaatgtgactattcttgggcgatttgattacagccag
tgtgacatttggtacatgaggttttctatggatttctggcaaaagatgcttgcattgggc
aatcaagttggcaaactttatgtttgggatttagaagtagaagatcctcataaagccaaa
tgtacaacactgactcatcataaatgtggtgctgctattcgacaaaccagttttagcagg
gatagcagcattcttatagctgtttgtgatgatgccagtatttggcgctgggatcgactt
cgataa

DBGET integrated database retrieval system