KEGG   Homo sapiens (human): 873Help
Entry
873               CDS       T01001                                 

Gene name
CBR1, CBR, SDR21C1, hCBR1
Definition
(RefSeq) carbonyl reductase 1
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa00790  Folate biosynthesis
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    873 (CBR1)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    873 (CBR1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    873 (CBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    873 (CBR1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     873 (CBR1)
    1.1.1.189  prostaglandin-E2 9-reductase
     873 (CBR1)
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     873 (CBR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_4
Motif
Other DBs
NCBI-GeneID: 873
NCBI-ProteinID: NP_001748
OMIM: 114830
HGNC: 1548
Ensembl: ENSG00000159228
Vega: OTTHUMG00000086618
Pharos: P16152(Tchem)
UniProt: P16152 A0A384NL53
Structure
PDB: 

Position
21q22.12
AA seq 277 aa AA seqDB search
MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFH
QLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRD
VCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTK
KGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKA
TKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccggcatccatgtagcgctggtgactggaggcaacaagggcatcggcttggcc
atcgtgcgcgacctgtgccggctgttctcgggggacgtggtgctcacggcgcgggacgtg
acgcggggccaggcggccgtacagcagctgcaggcggagggcctgagcccgcgcttccac
cagctggacatcgacgatctgcagagcatccgcgccctgcgcgacttcctgcgcaaggag
tacgggggcctggacgtgctggtcaacaacgcgggcatcgccttcaaggttgctgatccc
acaccctttcatattcaagctgaagtgacgatgaaaacaaatttctttggtacccgagat
gtgtgcacagaattactccctctaataaaaccccaagggagagtggtgaacgtatctagc
atcatgagcgtcagagcccttaaaagctgcagcccagagctgcagcagaagttccgcagt
gagaccatcactgaggaggagctggtggggctcatgaacaagtttgtggaggatacaaag
aagggagtgcaccagaaggagggctggcccagcagcgcatacggggtgacgaagattggc
gtcaccgttctgtccaggatccacgccaggaaactgagtgagcagaggaaaggggacaag
atcctcctgaatgcctgctgcccagggtgggtgagaactgacatggcgggacccaaggcc
accaagagcccagaagaaggtgcagagacccctgtgtacttggcccttttgcccccagat
gctgagggtccccatggacaatttgtttcagagaagagagttgaacagtggtga

DBGET integrated database retrieval system