KEGG   Homo sapiens (human): 873
Entry
873               CDS       T01001                                 

Symbol
CBR1, CBR, PG-9-KR, SDR21C1, hCBR1
Name
(RefSeq) carbonyl reductase 1
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa00790  Folate biosynthesis
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis - DNA adducts
hsa05208  Chemical carcinogenesis - reactive oxygen species
Network
nt06250  DNA adduct formation
  Element
N01381  NNK to DNA adducts
N01382  NNK to DNA adducts
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    873 (CBR1)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    873 (CBR1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    873 (CBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    873 (CBR1)
   05208 Chemical carcinogenesis - reactive oxygen species
    873 (CBR1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     873 (CBR1)
    1.1.1.189  prostaglandin-E2 9-reductase
     873 (CBR1)
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     873 (CBR1)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_4
Other DBs
NCBI-GeneID: 873
NCBI-ProteinID: NP_001748
OMIM: 114830
HGNC: 1548
Ensembl: ENSG00000159228
Vega: OTTHUMG00000086618
Pharos: P16152(Tchem)
UniProt: P16152 A0A384NL53
Structure
PDB: 

Position
21q22.12
AA seq 277 aa
MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFH
QLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRD
VCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTK
KGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKA
TKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
NT seq 834 nt   +upstreamnt  +downstreamnt
atgtcgtccggcatccatgtagcgctggtgactggaggcaacaagggcatcggcttggcc
atcgtgcgcgacctgtgccggctgttctcgggggacgtggtgctcacggcgcgggacgtg
acgcggggccaggcggccgtacagcagctgcaggcggagggcctgagcccgcgcttccac
cagctggacatcgacgatctgcagagcatccgcgccctgcgcgacttcctgcgcaaggag
tacgggggcctggacgtgctggtcaacaacgcgggcatcgccttcaaggttgctgatccc
acaccctttcatattcaagctgaagtgacgatgaaaacaaatttctttggtacccgagat
gtgtgcacagaattactccctctaataaaaccccaagggagagtggtgaacgtatctagc
atcatgagcgtcagagcccttaaaagctgcagcccagagctgcagcagaagttccgcagt
gagaccatcactgaggaggagctggtggggctcatgaacaagtttgtggaggatacaaag
aagggagtgcaccagaaggagggctggcccagcagcgcatacggggtgacgaagattggc
gtcaccgttctgtccaggatccacgccaggaaactgagtgagcagaggaaaggggacaag
atcctcctgaatgcctgctgcccagggtgggtgagaactgacatggcgggacccaaggcc
accaagagcccagaagaaggtgcagagacccctgtgtacttggcccttttgcccccagat
gctgagggtccccatggacaatttgtttcagagaagagagttgaacagtggtga

KEGG   Homo sapiens (human): 874
Entry
874               CDS       T01001                                 

Symbol
CBR3, HEL-S-25, SDR21C2, hCBR3
Name
(RefSeq) carbonyl reductase 3
  KO
K00084  carbonyl reductase 3 [EC:1.1.1.184]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    874 (CBR3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    874 (CBR3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     874 (CBR3)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 874
NCBI-ProteinID: NP_001227
OMIM: 603608
HGNC: 1549
Ensembl: ENSG00000159231
Vega: OTTHUMG00000086617
Pharos: O75828(Tbio)
UniProt: O75828 V9HW40
Structure
PDB: 
2HRB

Position
21q22.12
AA seq 277 aa
MSSCSRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRFH
QLDIDDLQSIRALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRN
MCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTK
NEVHEREGWPNSPYGVSKLGVTVLSRILARRLDEKRKADRILVNACCPGPVKTDMDGKDS
IRTVEEGAETPVYLALLPPDATEPQGQLVHDKVVQNW
NT seq 834 nt   +upstreamnt  +downstreamnt
atgtcgtcctgcagccgcgtggcgctggtgaccggggccaacaggggcatcggcttggcc
atcgcgcgcgaactgtgccgacagttctctggggatgtggtgctcaccgcgcgggacgtg
gcgcggggccaggcggccgtgcagcagctgcaggcggagggcctgagcccgcgcttccac
caactggacatcgacgacttgcagagcatccgcgccctgcgcgacttcctgcgcaaggag
tacggggggctcaacgtactggtcaacaacgcggccgtcgccttcaagagtgatgatcca
atgccctttgacattaaagctgagatgacactgaagacaaatttttttgccactagaaac
atgtgcaacgagttactgccgataatgaaacctcatgggagagtggtgaatatcagtagt
ttgcagtgtttaagggcttttgaaaactgcagtgaagatctgcaggaaaggttccacagt
gagacactcacagaaggagacctggtggatctcatgaaaaagtttgtggaggacacaaaa
aatgaggtgcatgagagggaaggctggcccaactcaccttatggggtgtccaagttgggg
gtcacggtcttatcgaggatcctggccaggcgtctggatgagaagaggaaagctgacagg
attctggtgaatgcgtgctgcccaggaccagtgaagacagacatggatgggaaagacagc
atcaggactgtggaggagggggctgagacccctgtctacttggccctcttgcctccagat
gccactgagccacaaggccagttggtccatgacaaagttgtgcaaaactggtaa

DBGET integrated database retrieval system