KEGG   Homo sapiens (human): 8737Help
Entry
8737              CDS       T01001                                 

Gene name
RIPK1, RIP, RIP-1, RIP1
Definition
(RefSeq) receptor interacting serine/threonine kinase 1
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04668  TNF signaling pathway
hsa05160  Hepatitis C
hsa05163  Human cytomegalovirus infection
hsa05169  Epstein-Barr virus infection
Network
N00151  TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    8737 (RIPK1)
   04668 TNF signaling pathway
    8737 (RIPK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    8737 (RIPK1)
   04217 Necroptosis
    8737 (RIPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    8737 (RIPK1)
   04621 NOD-like receptor signaling pathway
    8737 (RIPK1)
   04622 RIG-I-like receptor signaling pathway
    8737 (RIPK1)
   04623 Cytosolic DNA-sensing pathway
    8737 (RIPK1)
 09160 Human Diseases
  09167 Infectious diseases
   05160 Hepatitis C
    8737 (RIPK1)
   05163 Human cytomegalovirus infection
    8737 (RIPK1)
   05169 Epstein-Barr virus infection
    8737 (RIPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8737 (RIPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8737 (RIPK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   8737 (RIPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Death RHIM Kinase-like RIO1 Kdo
Motif
Other DBs
NCBI-GeneID: 8737
NCBI-ProteinID: NP_003795
OMIM: 603453
HGNC: 10019
Ensembl: ENSG00000137275
Vega: OTTHUMG00000014134
Pharos: Q13546(Tchem)
UniProt: Q13546 A0A024QZU0
Structure
PDB: 

Position
6p25.2
AA seq 671 aa AA seqDB search
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ
IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVSQN
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccagacatgtccttgaatgtcattaagatgaaatccagtgacttcctggagagt
gcagaactggacagcggaggctttgggaaggtgtctctgtgtttccacagaacccaggga
ctcatgatcatgaaaacagtgtacaaggggcccaactgcattgagcacaacgaggccctc
ttggaggaggcgaagatgatgaacagactgagacacagccgggtggtgaagctcctgggc
gtcatcatagaggaagggaagtactccctggtgatggagtacatggagaagggcaacctg
atgcacgtgctgaaagccgagatgagtactccgctttctgtaaaaggaaggataattttg
gaaatcattgaaggaatgtgctacttacatggaaaaggcgtgatacacaaggacctgaag
cctgaaaatatccttgttgataatgacttccacattaagatcgcagacctcggccttgcc
tcctttaagatgtggagcaaactgaataatgaagagcacaatgagctgagggaagtggac
ggcaccgctaagaagaatggcggcaccctctactacatggcgcccgagcacctgaatgac
gtcaacgcaaagcccacagagaagtcggatgtgtacagctttgctgtagtactctgggcg
atatttgcaaataaggagccatatgaaaatgctatctgtgagcagcagttgataatgtgc
ataaaatctgggaacaggccagatgtggatgacatcactgagtactgcccaagagaaatt
atcagtctcatgaagctctgctgggaagcgaatccggaagctcggccgacatttcctggc
attgaagaaaaatttaggcctttttatttaagtcaattagaagaaagtgtagaagaggac
gtgaagagtttaaagaaagagtattcaaacgaaaatgcagttgtgaagagaatgcagtct
cttcaacttgattgtgtggcagtaccttcaagccggtcaaattcagccacagaacagcct
ggttcactgcacagttcccagggacttgggatgggtcctgtggaggagtcctggtttgct
ccttccctggagcacccacaagaagagaatgagcccagcctgcagagtaaactccaagac
gaagccaactaccatctttatggcagccgcatggacaggcagacgaaacagcagcccaga
cagaatgtggcttacaacagagaggaggaaaggagacgcagggtctcccatgaccctttt
gcacagcaaagaccttacgagaattttcagaatacagagggaaaaggcactgcttattcc
agtgcagccagtcatggtaatgcagtgcaccagccctcagggctcaccagccaacctcaa
gtactgtatcagaacaatggattatatagctcacatggctttggaacaagaccactggat
ccaggaacagcaggtcccagagtttggtacaggccaattccaagtcatatgcctagtctg
cataatatcccagtgcctgagaccaactatctaggaaatacacccaccatgccattcagc
tccttgccaccaacagatgaatctataaaatataccatatacaatagtactggcattcag
attggagcctacaattatatggagattggtgggacgagttcatcactactagacagcaca
aatacgaacttcaaagaagagccagctgctaagtaccaagctatctttgataataccact
agtctgacggataaacacctggacccaatcagggaaaatctgggaaagcactggaaaaac
tgtgcccgtaaactgggcttcacacagtctcagattgatgaaattgaccatgactatgag
cgagatggactgaaagaaaaggtttaccagatgctccaaaagtgggtgatgagggaaggc
ataaagggagccacggtggggaagctggcccaggcgctccaccagtgttccaggatcgac
cttctgagcagcttgatttacgtcagccagaactaa

DBGET integrated database retrieval system