KEGG   Homo sapiens (human): 874Help
Entry
874               CDS       T01001                                 

Gene name
CBR3, HEL-S-25, SDR21C2, hCBR3
Definition
(RefSeq) carbonyl reductase 3
  KO
K00084  carbonyl reductase 3 [EC:1.1.1.184]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    874 (CBR3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    874 (CBR3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     874 (CBR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 874
NCBI-ProteinID: NP_001227
OMIM: 603608
HGNC: 1549
Ensembl: ENSG00000159231
Vega: OTTHUMG00000086617
Pharos: O75828(Tbio)
UniProt: O75828 V9HW40
Structure
PDB: 

Position
21q22.12
AA seq 277 aa AA seqDB search
MSSCSRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRFH
QLDIDDLQSIRALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRN
MCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTK
NEVHEREGWPNSPYGVSKLGVTVLSRILARRLDEKRKADRILVNACCPGPVKTDMDGKDS
IRTVEEGAETPVYLALLPPDATEPQGQLVHDKVVQNW
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctgcagccgcgtggcgctggtgaccggggccaacaggggcatcggcttggcc
atcgcgcgcgaactgtgccgacagttctctggggatgtggtgctcaccgcgcgggacgtg
gcgcggggccaggcggccgtgcagcagctgcaggcggagggcctgagcccgcgcttccac
caactggacatcgacgacttgcagagcatccgcgccctgcgcgacttcctgcgcaaggag
tacggggggctcaacgtactggtcaacaacgcggccgtcgccttcaagagtgatgatcca
atgccctttgacattaaagctgagatgacactgaagacaaatttttttgccactagaaac
atgtgcaacgagttactgccgataatgaaacctcatgggagagtggtgaatatcagtagt
ttgcagtgtttaagggcttttgaaaactgcagtgaagatctgcaggaaaggttccacagt
gagacactcacagaaggagacctggtggatctcatgaaaaagtttgtggaggacacaaaa
aatgaggtgcatgagagggaaggctggcccaactcaccttatggggtgtccaagttgggg
gtcacggtcttatcgaggatcctggccaggcgtctggatgagaagaggaaagctgacagg
attctggtgaatgcgtgctgcccaggaccagtgaagacagacatggatgggaaagacagc
atcaggactgtggaggagggggctgagacccctgtctacttggccctcttgcctccagat
gccactgagccacaaggccagttggtccatgacaaagttgtgcaaaactggtaa

DBGET integrated database retrieval system