KEGG   Homo sapiens (human): 8740Help
Entry
8740              CDS       T01001                                 

Gene name
TNFSF14, CD258, HVEML, LIGHT, LTg
Definition
(RefSeq) TNF superfamily member 14
  KO
K05477  tumor necrosis factor ligand superfamily member 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    8740 (TNFSF14)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8740 (TNFSF14)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    8740 (TNFSF14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    8740 (TNFSF14)
   04090 CD Molecules [BR:hsa04090]
    8740 (TNFSF14)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   8740 (TNFSF14)
CD molecules [BR:hsa04090]
 Proteins
  8740 (TNFSF14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 8740
NCBI-ProteinID: NP_003798
OMIM: 604520
HGNC: 11930
Ensembl: ENSG00000125735
Vega: OTTHUMG00000181835
Pharos: O43557(Tbio)
UniProt: O43557
Structure
PDB: 

Position
19p13.3
AA seq 240 aa AA seqDB search
MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQ
LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGL
AFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELL
VSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaggagagtgtcgtacggccctcagtgtttgtggtggatggacagaccgacatccca
ttcacgaggctgggacgaagccaccggagacagtcgtgcagtgtggcccgggtgggtctg
ggtctcttgctgttgctgatgggggccgggctggccgtccaaggctggttcctcctgcag
ctgcactggcgtctaggagagatggtcacccgcctgcctgacggacctgcaggctcctgg
gagcagctgatacaagagcgaaggtctcacgaggtcaacccagcagcgcatctcacaggg
gccaactccagcttgaccggcagcggggggccgctgttatgggagactcagctgggcctg
gccttcctgaggggcctcagctaccacgatggggcccttgtggtcaccaaagctggctac
tactacatctactccaaggtgcagctgggcggtgtgggctgcccgctgggcctggccagc
accatcacccacggcctctacaagcgcacaccccgctaccccgaggagctggagctgttg
gtcagccagcagtcaccctgcggacgggccaccagcagctcccgggtctggtgggacagc
agcttcctgggtggtgtggtacacctggaggctggggagaaggtggtcgtccgtgtgctg
gatgaacgcctggttcgactgcgtgatggtacccggtcttacttcggggctttcatggtg
tga

DBGET integrated database retrieval system