KEGG   Homo sapiens (human): 8745Help
Entry
8745              CDS       T01001                                 

Gene name
ADAM23, MDC-3, MDC3
Definition
(RefSeq) ADAM metallopeptidase domain 23
  KO
K06837  disintegrin and metalloproteinase domain-containing protein 23 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    8745 (ADAM23)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     8745 (ADAM23)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   8745 (ADAM23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin Pep_M12B_propep ADAM_CR Disintegrin Reprolysin_5 Reprolysin_3 EGF_2 Reprolysin_2 Reprolysin_4
Motif
Other DBs
NCBI-GeneID: 8745
NCBI-ProteinID: NP_003803
OMIM: 603710
HGNC: 202
Ensembl: ENSG00000114948
Vega: OTTHUMG00000132919
Pharos: O75077(Tbio)
UniProt: O75077 A0A024R3W8
Position
2q33.3
AA seq 832 aa AA seqDB search
MKPPGSSSRQPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASS
RPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYY
INQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEI
HYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDE
KSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKY
LELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQID
ITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYG
LPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEY
RDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHC
SDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCY
NGECKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFL
LCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMC
LDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPP
KDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcccggcagcagctcgcggcagccgcccctggcgggctgcagccttgccggc
gcttcctgcggcccccaacgcggccccgccggctcggtgcctgccagcgccccggcccgc
acgccgccctgccgcctgcttctcgtccttctcctgctgcctccgctcgccgcctcgtcc
cggccccgcgcctggggggctgctgcgcccagcgctccgcattggaatgaaactgcagaa
aaaaatttgggagtcctggcagatgaagacaatacattgcaacagaatagcagcagtaat
atcagttacagcaatgcaatgcagaaagaaatcacactgccttcaagactcatatattac
atcaaccaagactcggaaagcccttatcacgttcttgacacaaaggcaagacaccagcaa
aaacataataaggctgtccatctggcccaggcaagcttccagattgaagccttcggctcc
aaattcattcttgacctcatactgaacaatggtttgttgtcttctgattatgtggagatt
cactacgaaaatgggaaaccacagtactctaagggtggagagcactgttactaccatgga
agcatcagaggcgtcaaagactccaaggtggctctgtcaacctgcaatggacttcatggc
atgtttgaagatgataccttcgtgtatatgatagagccactagagctggttcatgatgag
aaaagcacaggtcgaccacatataatccagaaaaccttggcaggacagtattctaagcaa
atgaagaatctcactatggaaagaggtgaccagtggccctttctctctgaattacagtgg
ttgaaaagaaggaagagagcagtgaatccatcacgtggtatatttgaagaaatgaaatat
ttggaacttatgattgttaatgatcacaaaacgtataagaagcatcgctcttctcatgca
cataccaacaactttgcaaagtccgtggtcaaccttgtggattctatttacaaggagcag
ctcaacaccagggttgtcctggtggctgtagagacctggactgagaaggatcagattgac
atcaccaccaaccctgtgcagatgctccatgagttctcaaaataccggcagcgcattaag
cagcatgctgatgctgtgcacctcatctcgcgggtgacatttcactataagagaagcagt
ctgagttactttggaggtgtctgttctcgcacaagaggagttggtgtgaatgagtatggt
cttccaatggcagtggcacaagtattatcgcagagcctggctcaaaaccttggaatccaa
tgggaaccttctagcagaaagccaaaatgtgactgcacagaatcctggggtggctgcatc
atggaggaaacaggggtgtcccattctcgaaaattttcaaagtgcagcattttggagtat
agagactttttacagagaggaggtggagcctgccttttcaacaggccaacaaagctattt
gagcccacggaatgtggaaatggatacgtggaagctggggaggagtgtgattgtggtttt
catgtggaatgctatggattatgctgtaagaaatgttccctctccaacggggctcactgc
agcgacgggccctgctgtaacaatacctcatgtctttttcagccacgagggtatgaatgc
cgggatgctgtgaacgagtgtgatattactgaatattgtactggagactctggtcagtgc
ccaccaaatcttcataagcaagacggatatgcatgcaatcaaaatcagggccgctgctac
aatggcgagtgcaagaccagagacaaccagtgtcagtacatctggggaacaaaggctgca
gggtctgacaagttctgctatgaaaagctgaatacagaaggcactgagaagggaaactgc
gggaaggatggagaccggtggattcagtgcagcaaacatgatgtgttctgtggattctta
ctctgtaccaatcttactcgagctccacgtattggtcaacttcagggtgagatcattcca
acttccttctaccatcaaggccgggtgattgactgcagtggtgcccatgtagttttagat
gatgatacggatgtgggctatgtagaagatggaacgccatgtggcccgtctatgatgtgt
ttagatcggaagtgcctacaaattcaagccctaaatatgagcagctgtccactcgattcc
aagggtaaagtctgttcgggccatggggtgtgtagtaatgaagccacctgcatttgtgat
ttcacctgggcagggacagattgcagtatccgggatccagttaggaaccttcaccccccc
aaggatgaaggacccaagggtcctagtgccaccaatctcataataggctccatcgctggt
gccatcctggtagcagctattgtccttgggggcacaggctggggatttaaaaatgtcaag
aagagaaggttcgatcctactcagcaaggccccatctga

DBGET integrated database retrieval system