KEGG   Homo sapiens (human): 8751
Entry
8751              CDS       T01001                                 

Gene name
ADAM15, MDC15
Definition
(RefSeq) ADAM metallopeptidase domain 15
  KO
K06836  disintegrin and metalloproteinase domain-containing protein 15 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    8751 (ADAM15)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     8751 (ADAM15)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   8751 (ADAM15)
SSDB
Motif
Pfam: Reprolysin ADAM_CR Disintegrin Pep_M12B_propep Reprolysin_5 Reprolysin_3 Reprolysin_2 Reprolysin_4 CD20 Peptidase_M10 DUF4953 Peptidase_M43
Other DBs
NCBI-GeneID: 8751
NCBI-ProteinID: NP_997080
OMIM: 605548
HGNC: 193
Ensembl: ENSG00000143537
Vega: OTTHUMG00000013898
Pharos: Q13444(Tbio)
UniProt: Q13444
Position
1q21.3
AA seq 863 aa
MRLALLWALGLLGAGSPLPSWPLPNIGGTEEQQAESEKAPREPLEPQVLQDDLPISLKKV
LQTSLPEPLRIKLELDGDSHILELLQNRELVPGRPTLVWYQPDGTRVVSEGHTLENCCYQ
GRVRGYAGSWVSICTCSGLRGLVVLTPERSYTLEQGPGDLQGPPIISRIQDLHLPGHTCA
LSWRESVHTQKPPEHPLGQRHIRRRRDVVTETKTVELVIVADHSEAQKYRDFQHLLNRTL
EVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDS
AQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDL
PGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPM
AAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQC
RPTRGDCDLPEFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQ
PAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLW
ETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSK
CHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTTGLLLSLLVLLVLVMLGASYWYRAR
LHQRLCQLKGPTCQYRAAQSGPSERPGPPQRALLARGTKQASALSFPAPPSRPLPPDPVS
KRLQAELADRPNPPTRPLPADPVVRSPKSQGPAKPPPPRKPLPADPQGRCPSGDLPGPGA
GIPPLVVPSRPAPPPPTVSSLYL
NT seq 2592 nt   +upstreamnt  +downstreamnt
atgcggctggcgctgctctgggccctggggctcctgggcgcgggcagccctctgccttcc
tggccgctcccaaatataggtggcactgaggagcagcaggcagagtcagagaaggccccg
agggagcccttggagccccaggtccttcaggacgatctcccaattagcctcaaaaaggtg
cttcagaccagtctgcctgagcccctgaggatcaagttggagctggacggtgacagtcat
atcctggagctgctacagaatagggagttggtcccaggccgcccaaccctggtgtggtac
cagcccgatggcactcgggtggtcagtgagggacacactttggagaactgctgctaccag
ggaagagtgcggggatatgcaggctcctgggtgtccatctgcacctgctctgggctcaga
ggcttggtggtcctgaccccagagagaagctataccctggagcaggggcctggggacctt
cagggtcctcccattatttcgcgaatccaagatctccacctgccaggccacacctgtgcc
ctgagctggcgggaatctgtacacactcagaagccaccagagcaccccctgggacagcgc
cacattcgccggaggcgggatgtggtaacagagaccaagactgtggagttggtgattgtg
gctgatcactcggaggcccagaaataccgggacttccagcacctgctaaaccgcacactg
gaagtggccctcttgctggacacattcttccggcccctgaatgtacgagtggcactagtg
ggcctggaggcctggacccagcgtgacctggtggagatcagcccaaacccagctgtcacc
ctcgaaaacttcctccactggcgcagggcacatttgctgcctcgattgccccatgacagt
gcccagctggtgactggtacttcattctctgggcctacggtgggcatggccattcagaac
tccatctgttctcctgacttctcaggaggtgtgaacatggaccactccaccagcatcctg
ggagtcgcctcctccatagcccatgagttgggccacagcctgggcctggaccatgatttg
cctgggaatagctgcccctgtccaggtccagccccagccaagacctgcatcatggaggcc
tccacagacttcctaccaggcctgaacttcagcaactgcagccgacgggccctggagaaa
gccctcctggatggaatgggcagctgcctcttcgaacggctgcctagcctaccccctatg
gctgctttctgcggaaatatgtttgtggagccgggcgagcagtgtgactgtggcttcctg
gatgactgcgtcgatccctgctgtgattctttgacctgccagctgaggccaggtgcacag
tgtgcatctgacggaccctgttgtcaaaattgccagctgcgcccgtctggctggcagtgt
cgtcctaccagaggggattgtgacttgcctgaattctgcccaggagacagctcccagtgt
ccccctgatgtcagcctaggggatggcgagccctgcgctggcgggcaagctgtgtgcatg
cacgggcgttgtgcctcctatgcccagcagtgccagtcactttggggacctggagcccag
cccgctgcgccactttgcctccagacagctaatactcggggaaatgcttttgggagctgt
gggcgcaaccccagtggcagttatgtgtcctgcacccctagagatgccatttgtgggcag
ctccagtgccagacaggtaggacccagcctctgctgggctccatccgggatctactctgg
gagacaatagatgtgaatgggactgagctgaactgcagctgggtgcacctggacctgggc
agtgatgtggcccagcccctcctgactctgcctggcacagcctgtggccctggcctggtg
tgtatagaccatcgatgccagcgtgtggatctcctgggggcacaggaatgtcgaagcaaa
tgccatggacatggggtctgtgacagcaacaggcactgctactgtgaggagggctgggca
ccccctgactgcaccactcagctcaaagcaaccagctccctgaccacagggctgctcctc
agcctcctggtcttattggtcctggtgatgcttggtgccagctactggtaccgtgcccgc
ctgcaccagcgactctgccagctcaagggacccacctgccagtacagggcagcccaatct
ggtccctctgaacggccaggacctccgcagagggccctgctggcacgaggcactaagcag
gctagtgctctcagcttcccggcccccccttccaggccgctgccgcctgaccctgtgtcc
aagagactccaggctgagctggctgaccgacccaatccccctacccgccctctgcccgct
gacccggtggtgagaagcccgaagtctcaggggccagccaagcccccacccccaaggaag
ccactgcctgccgacccccagggccggtgcccatcgggtgacctgcccggcccaggggct
ggaatcccgcccctagtggtaccctccagaccagcgccaccgcctccgacagtgtcctcg
ctctacctctga

DBGET integrated database retrieval system