KEGG   Homo sapiens (human): 8756Help
Entry
8756              CDS       T01001                                 

Gene name
ADAM7, ADAM_7, ADAM-7, EAPI, GP-83, GP83
Definition
(RefSeq) ADAM metallopeptidase domain 7
  KO
K16071  disintegrin and metalloproteinase domain-containing protein 7 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    8756 (ADAM7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     8756 (ADAM7)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   8756 (ADAM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin Pep_M12B_propep ADAM_CR Disintegrin Reprolysin_5 Reprolysin_3 Reprolysin_4 Reprolysin_2 Peptidase_M57
Motif
Other DBs
NCBI-GeneID: 8756
NCBI-ProteinID: NP_003808
OMIM: 607310
HGNC: 214
Ensembl: ENSG00000069206
Vega: OTTHUMG00000097859
Pharos: Q9H2U9(Tdark)
UniProt: Q9H2U9
Position
8p21.2
AA seq 754 aa AA seqDB search
MLPGCIFLMILLIPQVKEKFILGVEGQQLVRPKKLPLIQKRDTGHTHDDDILKTYEEELL
YEIKLNRKTLVLHLLRSREFLGSNYSETFYSMKGEAFTRHPQIMDHCFYQGSIVHEYDSA
ASISTCNGLRGFFRINDQRYLIEPVKYSDEGEHLVFKYNLRVPYGANYSCTELNFTRKTV
PGDNESEEDSKIKGIHDEKYVELFIVADDTVYRRNGHPHNKLRNRIWGMVNFVNMIYKTL
NIHVTLVGIEIWTHEDKIELYSNIETTLLRFSFWQEKILKTRKDFDHVVLLSGKWLYSHV
QGISYPGGMCLPYYSTSIIKDLLPDTNIIANRMAHQLGHNLGMQHDEFPCTCPSGKCVMD
SDGSIPALKFSKCSQNQYHQYLKDYKPTCMLNIPFPYNFHDFQFCGNKKLDEGEECDCGP
AQECTNPCCDAHTCVLKPGFTCAEGECCESCQIKKAGSICRPAKDECDFPEMCTGHSPAC
PKDQFRVNGFPCKNSEGYCFMGKCPTREDQCSELFDDEAIESHDICYKMNTKGNKFGYCK
NKENRFLPCEEKDVRCGKIYCTGGELSSLLGEDKTYHLKDPQKNATVKCKTIFLYHDSTD
IGLVASGTKCGEGMVCNNGECLNMEKVYISTNCPSQCNENPVDGHGLQCHCEEGQAPVAC
EETLHVTNITILVVVLVLVIVGIGVLILLVRYRKCIKLKQVQSPPTETLGVENKGYFGDE
QQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccgggtgtatattcttgatgattttactcattcctcaggttaaagaaaagttc
atccttggagtagagggtcaacaactggttcgtcctaaaaagcttcctctgatacagaag
cgagatactggacacacccatgatgatgacatactgaaaacgtatgaagaagaattgttg
tatgaaataaaactaaatagaaaaaccttagtccttcatcttctaagatccagggagttc
ctaggctcaaattacagtgaaacattctactccatgaaaggagaagcgttcaccaggcat
cctcagatcatggatcattgtttttaccaaggatccatagtacacgaatatgattcagct
gccagtatcagtacgtgtaatggtctaaggggattcttcagaataaacgaccaaagatac
ctcattgaaccagtgaaatactcagatgagggagaacatttggtgttcaaatataacctg
agggtgccgtatggtgccaattattcctgtacagagcttaattttaccagaaaaactgtt
ccaggggataatgaatctgaagaagactccaaaataaaaggcatccatgatgaaaagtat
gttgaattgttcattgttgctgatgatactgtgtatcgcagaaatggtcatcctcacaat
aaactaaggaaccgaatttggggaatggtcaattttgtcaacatgatttataaaacctta
aacatccatgtgacgttggttggcattgaaatatggacacatgaagataaaatagaacta
tattcaaatatagaaactaccttattgcgtttttcattttggcaagaaaagatccttaaa
acacggaaggattttgatcatgttgtattactcagtgggaagtggctctactcacatgtg
caaggaatttcttatccagggggtatgtgcctgccctattattccaccagtatcattaag
gatcttttacctgacacaaacataattgcaaacagaatggcacatcaactggggcataac
cttgggatgcagcatgacgagttcccatgcacctgtccttcaggaaaatgcgtgatggac
agtgatggaagcattcctgcactgaaattcagtaaatgcagccaaaaccaataccaccag
tacttgaaggattataagccaacatgcatgctcaacattccatttccttacaattttcat
gatttccaattttgtggaaacaagaagttggatgagggtgaagagtgtgactgtggccct
gctcaggagtgtactaatccttgctgtgatgcacacacatgtgtactgaagccaggattt
acttgtgcagaaggagaatgctgtgaatcttgtcagataaaaaaagcagggtccatatgc
agaccggcgaaagatgaatgtgattttcctgagatgtgcactggccactcgcctgcctgt
cctaaggaccagttcagggtcaatggatttccttgcaagaactcagaaggctactgtttc
atggggaaatgtccaactcgtgaggatcagtgctctgaactatttgatgatgaggcaata
gagagtcatgatatctgctacaagatgaatacaaaaggaaataaatttggatactgcaaa
aacaaggaaaacagatttcttccctgtgaggagaaagatgtcagatgtggaaagatctac
tgcactggaggggagctttcctctctccttggagaagacaagacttatcaccttaaggat
ccccagaagaatgctactgtcaaatgcaaaactatttttttataccatgattctacagac
attggcctggtggcgtcaggaacaaaatgtggagagggaatggtgtgcaacaatggtgaa
tgtctaaacatggaaaaggtctatatctcaaccaattgcccctctcagtgcaatgaaaat
cctgtggatggccacggactccagtgccactgtgaggaaggacaggcacctgtagcctgt
gaagaaaccttacatgttaccaatatcaccatcttggttgttgtgcttgtcctggttatt
gtcggtatcggagttcttatactattagttcgttaccgaaaatgtatcaagttgaagcaa
gttcagagcccacctacagaaaccctgggagtggagaacaaaggatactttggtgatgag
cagcagataaggactgagccaatcctgccagaaattcatttcctaaataaacctgcaagt
aaagattcaagaggaatcgcagatcccaatcaaagtgccaagtga

DBGET integrated database retrieval system