KEGG   Homo sapiens (human): 8760
Entry
8760              CDS       T01001                                 

Gene name
CDS2
Definition
(RefSeq) CDP-diacylglycerol synthase 2
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8760 (CDS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8760 (CDS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     8760 (CDS2)
SSDB
Motif
Pfam: CTP_transf_1
Other DBs
NCBI-GeneID: 8760
NCBI-ProteinID: NP_003809
OMIM: 603549
HGNC: 1801
Ensembl: ENSG00000101290
Vega: OTTHUMG00000031801
Pharos: O95674(Tbio)
UniProt: O95674
Position
20p12.3
AA seq 445 aa
MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALS
NLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSY
DLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCM
FVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAY
MFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSF
TVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGF
KRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQ
QLHIFNTLRSHLIDKGMLTSTTEDE
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgacagagctgaggcagagggtggcccatgagccggttgcgccacccgaggacaaggag
tcagagtcagaagcaaaggtagatggagagactgcatcggacagtgagagccgggcagaa
tccgcacccctgccagtctctgcagatgataccccggaggtcctcaatagggccctttcc
aacttgtcttcaagatggaagaactggtgggtgagaggcatcctgactttggccatgatt
gcatttttcttcatcatcatttacctgggaccaatggttttgatgataatcgtgatgtgc
gttcagattaagtgtttccatgagataatcactattggctacaacgtctaccactcatat
gatctgccctggttcaggacgctcagctggtactttctcctgtgtgtaaactatttcttc
tatggtgagacagtgacggattacttcttcaccctggtccagagagaagagcctttgcgg
attctcagtaaataccaccggttcatttcctttactctctatctaataggattctgcatg
tttgtactgagtctggtcaagaagcattatcgactgcagttctacatgtttggctggacc
catgtgacattgctgattgttgtaacacagtcacatcttgttatccacaacctatttgaa
ggaatgatctggttcattgtccccatatcttgtgtgatctgtaatgacatcatggcctat
atgtttggctttttctttggtcggaccccactcatcaagctgtccccgaagaagacctgg
gaaggcttcattgggggcttctttgctactgtggtgtttggccttctgctgtcctatgtg
atgtccgggtacagatgctttgtctgccctgtggagtacaacaatgacaccaacagcttc
actgtggactgtgagccctcggacctgtttcgcctgcaggagtacaacattcctggggtg
atccagtcagtcattggctggaaaacggtccggatgtaccccttccagattcacagcatc
gctctctccacctttgcctcgctcattggcccctttggaggattcttcgcaagtggattc
aaacgagcctttaaaatcaaagactttgccaataccattcctggccatggaggcatcatg
gatcgctttgactgccagtatctgatggccacctttgtcaatgtatacatcgccagtttt
atcagaggccctaacccaagcaaactgattcagcagttcctgactttacggccagatcag
cagctccacatcttcaacacgctgcggtctcatctgatcgacaaagggatgctgacatcc
accacagaggacgagtag

DBGET integrated database retrieval system