KEGG   Homo sapiens (human): 8767Help
Entry
8767              CDS       T01001                                 

Gene name
RIPK2, CARD3, CARDIAK, CCK, GIG30, RICK, RIP2
Definition
(RefSeq) receptor interacting serine/threonine kinase 2
  KO
K08846  receptor-interacting serine/threonine-protein kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05131  Shigellosis
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    8767 (RIPK2)
  Nervous system
   04722 Neurotrophin signaling pathway
    8767 (RIPK2)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    8767 (RIPK2)
   05152 Tuberculosis
    8767 (RIPK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8767 (RIPK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   8767 (RIPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase CARD Kdo
Motif
Other DBs
NCBI-GeneID: 8767
NCBI-ProteinID: NP_003812
OMIM: 603455
HGNC: 10020
Ensembl: ENSG00000104312
Vega: OTTHUMG00000163809
Pharos: O43353(Tchem)
UniProt: O43353 A0A0S2Z4Z8
Structure
PDB: 

Position
8q21.3
AA seq 540 aa AA seqDB search
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSER
KDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
SKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMY
SVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPET
SRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN
PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTK
PTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaacggggaggccatctgcagcgccctgcccaccattccctaccacaaactcgccgac
ctgcgctacctgagccgcggcgcctctggcactgtgtcgtccgcccgccacgcagactgg
cgcgtccaggtggccgtgaagcacctgcacatccacactccgctgctcgacagtgaaaga
aaggatgtcttaagagaagctgaaattttacacaaagctagatttagttacattcttcca
attttgggaatttgcaatgagcctgaatttttgggaatagttactgaatacatgccaaat
ggatcattaaatgaactcctacataggaaaactgaatatcctgatgttgcttggccattg
agatttcgcatcctgcatgaaattgcccttggtgtaaattacctgcacaatatgactcct
cctttacttcatcatgacttgaagactcagaatatcttattggacaatgaatttcatgtt
aagattgcagattttggtttatcaaagtggcgcatgatgtccctctcacagtcacgaagt
agcaaatctgcaccagaaggagggacaattatctatatgccacctgaaaactatgaacct
ggacaaaaatcaagggccagtatcaagcacgatatatatagctatgcagttatcacatgg
gaagtgttatccagaaaacagccttttgaagatgtcaccaatcctttgcagataatgtat
agtgtgtcacaaggacatcgacctgttattaatgaagaaagtttgccatatgatatacct
caccgagcacgtatgatctctctaatagaaagtggatgggcacaaaatccagatgaaaga
ccatctttcttaaaatgtttaatagaacttgaaccagttttgagaacatttgaagagata
acttttcttgaagctgttattcagctaaagaaaacaaagttacagagtgtttcaagtgcc
attcacctatgtgacaagaagaaaatggaattatctctgaacatacctgtaaatcatggt
ccacaagaggaatcatgtggatcctctcagctccatgaaaatagtggttctcctgaaact
tcaaggtccctgccagctcctcaagacaatgattttttatctagaaaagctcaagactgt
tattttatgaagctgcatcactgtcctggaaatcacagttgggatagcaccatttctgga
tctcaaagggctgcattctgtgatcacaagaccactccatgctcttcagcaataataaat
ccactctcaactgcaggaaactcagaacgtctgcagcctggtatagcccagcagtggatc
cagagcaaaagggaagacattgtgaaccaaatgacagaagcctgccttaaccagtcgcta
gatgcccttctgtccagggacttgatcatgaaagaggactatgaacttgttagtaccaag
cctacaaggacctcaaaagtcagacaattactagacactactgacatccaaggagaagaa
tttgccaaagttatagtacaaaaattgaaagataacaaacaaatgggtcttcagccttac
ccggaaatacttgtggtttctagatcaccatctttaaatttacttcaaaataaaagcatg
taa

DBGET integrated database retrieval system