KEGG   Homo sapiens (human): 8771Help
Entry
8771              CDS       T01001                                 

Gene name
TNFRSF6B, DCR3, DJ583P15.1.1, M68, M68E, TR6
Definition
(RefSeq) TNF receptor superfamily member 6b
  KO
K05143  tumor necrosis factor receptor superfamily member 6B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Disease
H00108  Autoimmune lymphoproliferative syndromes (ALPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8771 (TNFRSF6B)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   8771 (TNFRSF6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 ExoD
Motif
Other DBs
NCBI-GeneID: 8771
NCBI-ProteinID: NP_003814
OMIM: 603361
HGNC: 11921
Ensembl: ENSG00000243509
Vega: OTTHUMG00000143724
Pharos: O95407(Tbio)
UniProt: O95407
Structure
PDB: 

Position
20q13.33
AA seq 300 aa AA seqDB search
MRALEGPGLSLLCLVLALPALLPVPAVRGVAETPTYPWRDAETGERLVCAQCPPGTFVQR
PCRRDSPTTCGPCPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFF
AHAGFCLEHASCPPGAGVIAPGTPSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGLA
LNVPGSSSHDTLCTSCTGFPLSTRVPGAEECERAVIDFVAFQDISIKRLQRLLQALEAPE
GWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQALRVARMPGLERSVRERFLPVH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgctggaggggccaggcctgtcgctgctgtgcctggtgttggcgctgcctgcc
ctgctgccggtgccggctgtacgcggagtggcagaaacacccacctacccctggcgggac
gcagagacaggggagcggctggtgtgcgcccagtgccccccaggcacctttgtgcagcgg
ccgtgccgccgagacagccccacgacgtgtggcccgtgtccaccgcgccactacacgcag
ttctggaactacctagagcgctgccgctactgcaacgtcctctgcggggagcgtgaggag
gaggcacgggcttgccacgccacccacaaccgtgcctgccgctgccgcaccggcttcttc
gcgcacgctggtttctgcttggagcacgcatcgtgtccacctggtgccggcgtgattgcc
ccgggcacccccagccagaacacgcagtgccagccgtgccccccaggcaccttctcagcc
agcagctccagctcagagcagtgccagccccaccgcaactgcacggccctgggcctggcc
ctcaatgtgccaggctcttcctcccatgacaccctgtgcaccagctgcactggcttcccc
ctcagcaccagggtaccaggagctgaggagtgtgagcgtgccgtcatcgactttgtggct
ttccaggacatctccatcaagaggctgcagcggctgctgcaggccctcgaggccccggag
ggctggggtccgacaccaagggcgggccgcgcggccttgcagctgaagctgcgtcggcgg
ctcacggagctcctgggggcgcaggacggggcgctgctggtgcggctgctgcaggcgctg
cgcgtggccaggatgcccgggctggagcggagcgtccgtgagcgcttcctccctgtgcac
tga

DBGET integrated database retrieval system