KEGG   Homo sapiens (human): 8772Help
Entry
8772              CDS       T01001                                 

Gene name
FADD, GIG3, MORT1
Definition
(RefSeq) Fas associated via death domain
  KO
K02373  FAS-associated death domain protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05010  Alzheimer disease
hsa05142  Chagas disease (American trypanosomiasis)
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
Network
N00145  Extrinsic apoptotic pathway
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00193  HPV E6 to host-cell-protein inhibition
N00350  HPV E6 to extrinsic apoptotic pathway
N00351  HPV E6 to extrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    8772 (FADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    8772 (FADD)
   04215 Apoptosis - multiple species
    8772 (FADD)
   04217 Necroptosis
    8772 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    8772 (FADD)
   04621 NOD-like receptor signaling pathway
    8772 (FADD)
   04622 RIG-I-like receptor signaling pathway
    8772 (FADD)
   04657 IL-17 signaling pathway
    8772 (FADD)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    8772 (FADD)
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    8772 (FADD)
  09167 Infectious diseases
   05152 Tuberculosis
    8772 (FADD)
   05161 Hepatitis B
    8772 (FADD)
   05168 Herpes simplex infection
    8772 (FADD)
   05163 Human cytomegalovirus infection
    8772 (FADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    8772 (FADD)
   05165 Human papillomavirus infection
    8772 (FADD)
   05142 Chagas disease (American trypanosomiasis)
    8772 (FADD)
  09168 Drug resistance
   01524 Platinum drug resistance
    8772 (FADD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DED Death
Motif
Other DBs
NCBI-GeneID: 8772
NCBI-ProteinID: NP_003815
OMIM: 602457
HGNC: 3573
Ensembl: ENSG00000168040
Vega: OTTHUMG00000167264
Pharos: Q13158(Tbio)
UniProt: Q13158
Structure
PDB: 

Position
11q13.3
AA seq 208 aa AA seqDB search
MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHT
ELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLK
VSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEV
QQARDLQNRSGAMSPMSWNSDASTSEAS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggacccgttcctggtgctgctgcactcggtgtcgtccagcctgtcgagcagcgagctg
accgagctcaagttcctatgcctcgggcgcgtgggcaagcgcaagctggagcgcgtgcag
agcggcctagacctcttctccatgctgctggagcagaacgacctggagcccgggcacacc
gagctcctgcgcgagctgctcgcctccctgcggcgccacgacctgctgcggcgcgtcgac
gacttcgaggcgggggcggcggccggggccgcgcctggggaagaagacctgtgtgcagca
tttaacgtcatatgtgataatgtggggaaagattggagaaggctggctcgtcagctcaaa
gtctcagacaccaagatcgacagcatcgaggacagatacccccgcaacctgacagagcgt
gtgcgggagtcactgagaatctggaagaacacagagaaggagaacgcaacagtggcccac
ctggtgggggctctcaggtcctgccagatgaacctggtggctgacctggtacaagaggtt
cagcaggcccgtgacctccagaacaggagtggggccatgtccccgatgtcatggaactca
gacgcatctacctccgaagcgtcctga

DBGET integrated database retrieval system