KEGG   Homo sapiens (human): 8775
Entry
8775              CDS       T01001                                 

Gene name
NAPA, SNAPA
Definition
(RefSeq) NSF attachment protein alpha
  KO
K15296  alpha-soluble NSF attachment protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    8775 (NAPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8775 (NAPA)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Others
    8775 (NAPA)
SSDB
Motif
Pfam: SNAP TPR_12 TPR_7 Spatacsin_C
Other DBs
NCBI-GeneID: 8775
NCBI-ProteinID: NP_003818
OMIM: 603215
HGNC: 7641
Ensembl: ENSG00000105402
Vega: OTTHUMG00000183294
Pharos: P54920(Tbio)
UniProt: P54920 A0A024R0R9
Position
19q13.32-q13.33
AA seq 295 aa
MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSA
AGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIA
AKHHISIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQK
AIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRE
CKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR
NT seq 888 nt   +upstreamnt  +downstreamnt
atggacaattccgggaaggaagcggaggcgatggcgctgttggccgaggcggagcgcaaa
gtgaagaactcgcagtccttcttctctggcctctttggaggctcatccaaaatagaggaa
gcatgcgaaatctacgccagagcagcaaacatgttcaaaatggccaaaaactggagtgct
gctggaaacgcgttctgccaggctgcacagctgcacctgcagctccagagcaagcacgac
gcagccacctgctttgtggacgctggcaacgcattcaagaaagccgacccccaagaggcc
attaactgtttgatgcgagcaatcgagatctacacagacatgggccgattcacgattgcg
gccaagcaccacatctccattgctgagatctatgagacagagttggtggacatcgagaag
gccattgcccactacgagcagtctgcagactactacaaaggcgaggagtccaacagctca
gccaacaagtgtctgctgaaggtggctggttacgctgcgctgctggagcagtatcagaag
gccattgacatctacgaacaggtggggaccaatgccatggacagccccctcctcaagtac
agcgccaaagactacttcttcaaggcggccctctgccacttctgcatcgacatgctcaac
gccaagctggctgtccaaaagtatgaggagctgttcccagctttctctgattcccgggaa
tgcaagttgatgaaaaaattgctagaggcccacgaggagcagaatgtggacagctacacc
gagtcggtgaaggaatacgactccatctcccggctggaccagtggctcaccaccatgctg
ctgcgcatcaagaagaccatccagggcgatgaggaggacctgcgctaa

DBGET integrated database retrieval system