KEGG   Homo sapiens (human): 8780Help
Entry
8780              CDS       T01001                                 

Gene name
RIOK3, SUDD
Definition
(RefSeq) RIO kinase 3
  KO
K08872  RIO kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8780 (RIOK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8780 (RIOK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  RIO family [OT]
   8780 (RIOK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RIO1 Kdo Pkinase APH
Motif
Other DBs
NCBI-GeneID: 8780
NCBI-ProteinID: NP_003822
OMIM: 603579
HGNC: 11451
Ensembl: ENSG00000101782
Vega: OTTHUMG00000131813
Pharos: O14730(Tchem)
UniProt: O14730 B0YJ89
Position
18q11.2
AA seq 519 aa AA seqDB search
MDLVGVASPEPGTAAAWGPSKCPWAIPQNTISCSLADVMSEQLAKELQLEEEAAVFPEVA
VAEGPFITGENIDTSSDLMLAQMLQMEYDREYDAQLRREEKKFNGDSKVSISFENYRKVH
PYEDSDSSEDEVDWQDTRDDPYRPAKPVPTPKKGFIGKGKDITTKHDEVVCGRKNTARME
NFAPEFQVGDGIGMDLKLSNHVFNALKQHAYSEERRSARLHEKKEHSTAEKAVDPKTRLL
MYKMVNSGMLETITGCISTGKESVVFHAYGGSMEDEKEDSKVIPTECAIKVFKTTLNEFK
NRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVVLLKKHILVMS
FIGHDQVPAPKLKEVKLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVW
LIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEAD
FLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggatctggtaggagtggcatcgcctgagcccgggacggcagcggcctggggacccagc
aagtgtccatgggctattcctcaaaatacaatatcttgttctttggctgatgtaatgagt
gaacagctggccaaagaattgcagttagaagaagaagctgccgtttttcctgaagttgct
gttgctgaaggaccatttattactggagaaaacattgatacttccagtgaccttatgctg
gctcagatgctacagatggaatatgacagagaatatgatgcacagcttaggcgtgaagaa
aaaaaattcaatggagatagcaaagtttccatttcctttgaaaattatcgaaaagtgcat
ccttatgaagacagcgatagctctgaagatgaggttgactggcaggatactcgtgatgat
ccctacagaccagcaaaaccggttcccactcctaaaaagggctttattggaaaaggaaaa
gatatcaccaccaaacatgatgaagtagtatgtgggagaaagaacacagcaagaatggaa
aattttgcacctgagtttcaggtaggagatggaattggaatggatttaaaactatcaaac
catgttttcaatgctttaaaacaacatgcctactcagaagaacgtcgaagtgcccgccta
catgagaaaaaggagcattctacagcagaaaaagcagttgatcctaagacacgtttactt
atgtataaaatggtcaactctggaatgttggagacaatcactggctgtattagtacagga
aaggagtctgttgtctttcatgcatatggagggagcatggaggatgaaaaggaagatagt
aaagttatacctacagaatgtgccatcaaggtatttaaaacaacccttaatgaatttaag
aatcgtgacaaatatattaaagatgatttcaggtttaaagatcgcttcagtaaactaaat
ccacgtaagatcatccgcatgtgggcagaaaaagaaatgcacaatctcgcaagaatgcag
agagctggaattccttgtccaacagttgtactactgaagaaacacattttagttatgtct
tttattggccatgatcaagttccagcccctaaattaaaagaagtaaagctcaatagtgaa
gaaatgaaagaagcctactatcaaactcttcatttgatgcggcagttatatcatgaatgt
acgcttgtccatgctgacctcagtgagtataacatgctgtggcatgctggaaaggtctgg
ttgatcgatgtcagtcagtcagtagaacctacccaccctcacggcctggagttcttgttc
cgggactgcaggaatgtctcgcagtttttccagaaaggaggagtcaaggaagcccttagt
gaacgagaactcttcaatgctgtttcaggcttaaacatcacagcagataatgaagctgat
tttttagctgagatagaagctttggagaaaatgaatgaagatcacgttcagaagaatgga
aggaaagctgcttcatttttgaaagatgatggagacccaccactactatatgatgaatag

DBGET integrated database retrieval system