KEGG   Homo sapiens (human): 8784Help
Entry
8784              CDS       T01001                                 

Gene name
TNFRSF18, AITR, CD357, GITR, GITR-D
Definition
(RefSeq) TNF receptor superfamily member 18
  KO
K05154  tumor necrosis factor receptor superfamily member 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8784 (TNFRSF18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8784 (TNFRSF18)
   04090 CD molecules [BR:hsa04090]
    8784 (TNFRSF18)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   8784 (TNFRSF18)
CD molecules [BR:hsa04090]
 Proteins
  8784 (TNFRSF18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 8784
NCBI-ProteinID: NP_004186
OMIM: 603905
HGNC: 11914
Ensembl: ENSG00000186891
Vega: OTTHUMG00000001414
Pharos: Q9Y5U5(Tbio)
UniProt: Q9Y5U5
Position
1p36.33
AA seq 241 aa AA seqDB search
MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRD
YPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTF
SGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLL
TSAQLGLHIWQLRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLW
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcacggggcgatgggcgcgtttcgggccctgtgcggcctggcgctgctgtgc
gcgctcagcctgggtcagcgccccaccgggggtcccgggtgcggccctgggcgcctcctg
cttgggacgggaacggacgcgcgctgctgccgggttcacacgacgcgctgctgccgcgat
tacccgggcgaggagtgctgttccgagtgggactgcatgtgtgtccagcctgaattccac
tgcggagacccttgctgcacgacctgccggcaccacccttgtcccccaggccagggggta
cagtcccaggggaaattcagttttggcttccagtgtatcgactgtgcctcggggaccttc
tccgggggccacgaaggccactgcaaaccttggacagactgcacccagttcgggtttctc
actgtgttccctgggaacaagacccacaacgctgtgtgcgtcccagggtccccgccggca
gagccgcttgggtggctgaccgtcgtcctcctggccgtggccgcctgcgtcctcctcctg
acctcggcccagcttggactgcacatctggcagctgaggagtcagtgcatgtggccccga
gagacccagctgctgctggaggtgccgccgtcgaccgaagacgccagaagctgccagttc
cccgaggaagagcggggcgagcgatcggcagaggagaaggggcggctgggagacctgtgg
gtgtga

DBGET integrated database retrieval system