KEGG   Homo sapiens (human): 8786
Entry
8786              CDS       T01001                                 
Symbol
RGS11, RS11
Name
(RefSeq) regulator of G protein signaling 11
  KO
K16449  regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    8786 (RGS11)
SSDB
Motif
Pfam: RGS_DHEX RGS DEP G-gamma
Other DBs
NCBI-GeneID: 8786
NCBI-ProteinID: NP_899180
OMIM: 603895
HGNC: 9993
Ensembl: ENSG00000076344
Pharos: O94810(Tbio)
UniProt: O94810 Q4TT70
Position
16:complement(268307..275944)
AA seq 467 aa
MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQW
LAQKFCVSEEEALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRFQTPYFWTSTLRPAAE
LDYAIYLAKKNIRKRGTLVDYEKDCYDRLHKKINHAWDLVLMQAREQLRAAKQRSKGDRL
VIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIEYFRKALGRT
RVKSSVCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDAYWVMNAPTVAAPTKLRVERW
GFSFRELLEDPVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTLVDAVYEQFLA
PGAAHWVNIDSRTMEQTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAE
AGIPLEMKRRVFPFTWRPRHSSPSPALLPTPVEPTAACGPGGGDGVA
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggccgccggccccgcgccgccccccggccgcccccgggcgcagatgccgcatctgagg
aagatggagcgggtggtcgtgagcatgcaggaccccgaccagggcgtgaagatgcggagc
cagcgcctgctggtcaccgtcattccccacgcggtgacaggcagcgacgtcgtgcagtgg
ttggcccagaagttctgcgtctcggaggaggaggccctgcacctgggcgccgtcctggtg
cagcatggctacatctacccgctgcgcgacccccgtagcctcatgctccggccagacgag
acgccctacaggttccagaccccgtacttctggacaagtaccctgaggccggctgcagag
ctggactatgccatctacctggccaagaagaacatccgaaaacgggggaccctggtggat
tatgagaaggactgctatgaccggctacacaagaagatcaaccacgcatgggacctggtg
ctgatgcaggcgagggagcagctgagggcagccaagcagcgcagcaagggggacaggctg
gtcattgcgtgccaggagcagacctactggctggtgaacaggcccccgcccggggccccc
gatgtgctggagcagggtccagggcggggatcctgcgctgccagccgtgtgctcatgacc
aagagtgcagatttccataagcgggagatcgagtacttcaggaaagcgctgggcaggacc
cgagtgaagtcctccgtctgccttgaggcgtacctgagtttctgcggccagcgtggaccc
cacgatcccctcgtgtcggggtgcctgcccagcaatccctggatctcagacaatgacgcc
tactgggtcatgaatgcccccacggtggctgcccccacgaagctccgtgtggagagatgg
ggcttcagcttccgggagctcctggaggaccccgtggggcgggcccacttcatggacttt
ctgggaaaggagttcagtggagaaaacctcagcttctgggaggcatgtgaggagcttcga
tatggagcgcaggcccaggtccccaccctggtggatgccgtgtacgagcagttcctggcc
cccggagctgcccactgggtcaacatcgacagccggaccatggagcagaccctggagggg
ctgcgccagccccaccgctatgtcctggatgacgcccagctgcacatatacatgctcatg
aagaaggactcctacccaaggttcctgaagtctgacatgtacaaggccctcctggcagag
gctgggatcccgctggagatgaagagacgcgtgttcccgtttacgtggaggccacggcac
tcgagccccagccctgcactccttcccacccctgtggagcccacagcggcttgtggccct
gggggtggagatggggtggcctag

DBGET integrated database retrieval system