KEGG   Homo sapiens (human): 8787Help
Entry
8787              CDS       T01001                                 

Gene name
RGS9, PERRS, RGS9L
Definition
(RefSeq) regulator of G protein signaling 9
  KO
K13765  regulator of G-protein signaling 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04744  Phototransduction
hsa05030  Cocaine addiction
Disease
H00973  Bradyopsia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04744 Phototransduction
    8787 (RGS9)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    8787 (RGS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS DEP G-gamma
Motif
Other DBs
NCBI-GeneID: 8787
NCBI-ProteinID: NP_003826
OMIM: 604067
HGNC: 10004
Ensembl: ENSG00000108370
Vega: OTTHUMG00000179349
Pharos: O75916(Tbio)
UniProt: O75916 A8K1G1
Position
17q24.1
AA seq 674 aa AA seqDB search
MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMQNQRVLVTSVPHAMTGSDVLQWIV
QRLWISSLEAQNLGNFIVRYGYIYPLQDPKNLILKPDGSLYRFQTPYFWPTQQWPAEDTD
YAIYLAKRNIKKKGILEEYEKENYNFLNQKMNYKWDFVIMQAKEQYRAGKERNKADRYAL
DCQEKAYWLVHRCPPGMDNVLDYGLDRVTNPNEVKVNQKQTVVAVKKEIMYYQQALMRST
VKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLNAKLVEIPTKMRVERWA
FNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAP
GARRWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKDMLAKA
IEPQETTKKSSTLPFMRRHLRSSPSPVILRQLEEEAKAREAANTVDITQPGQHMAPSPHL
TVYTGTCMPPSPSSPFSSSCRSPRKPFASPSRFIRRPSTTICPSPIRVALESSSGLEQKG
ECSGSMAPRGPSVTESSEASLDTSWPRSRPRAPPKARMALSFSRFLRRGCLASPVFARLS
PKCPAVSHGRVQPLGDVGQQLPRLKSKRVANFFQIKMDVPTGSGTCLMDSEDAGTGESGD
RATEKEVICPWESL
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccgacaccaaggccagcagtacaggccgaggatggcatttctccaaaagatt
gaagcgctcgtgaaggacatgcagaacccagagacaggggtccgaatgcagaaccagagg
gtcctggtcaccagcgttcctcatgccatgacaggaagtgatgttctgcaatggatcgtc
cagcggctttggatctccagtctggaggcacagaacttgggcaactttattgtcaggtat
ggctacatttaccccctgcaagaccccaagaatctcattctcaagcctgatggcagcctc
tacagatttcagacaccgtatttctggcccacccagcagtggccagctgaagataccgat
tacgccatctatctggccaagcgaaatatcaaaaagaaagggattttggaagaatatgaa
aaggaaaattacaatttcttgaaccaaaaaatgaactataagtgggactttgtcattatg
caggccaaagagcagtacagggctggaaaggagaggaacaaagcagacagatatgccctg
gactgccaggagaaggcatactggctggtgcaccgatgccctcctggaatggacaatgtg
ctggactacggcctggaccgagtgaccaatccgaatgaagtcaaggtaaaccagaaacaa
acagtcgttgctgtcaaaaaagagatcatgtattaccaacaggccttgatgaggtccaca
gtgaagtcttctgtgtccctgggagggattgtgaaatacagtgagcagttctcatccaac
gatgccatcatgtcaggctgcctccccagcaacccctggatcaccgatgacacccagttc
tgggacttaaatgccaaattggtggaaatcccaaccaagatgcgagtggaacgatgggcc
ttcaacttcagcgaattgatccgagaccccaaaggtcgacagagcttccagtacttcctc
aagaaagaattcagtggagagaatctgggattctgggaagcctgcgaggatctgaagtat
ggagatcagtccaaagtcaaggagaaagcagaggagatttacaagctgttcctggccccg
ggggcgaggcgctggatcaacatagatggcaaaaccatggacatcacagtgaaggggctg
aagcacccccaccgctatgtgctggacgccgcacaaacccacatttacatgctcatgaag
aaggattcttatgctcgctatttaaaatctccgatctataaggacatgctggccaaagct
attgaacctcaggaaaccaccaagaaaagctccaccctcccttttatgcggcgtcacctg
cgctccagcccaagccctgtcatcctgagacagctggaagaggaagccaaggcccgagaa
gcagccaacactgtggacatcacccagccgggccagcacatggctcccagcccccatctg
accgtgtacaccgggacctgcatgcccccgtctccttctagccccttctcctcctcctgc
cgctcccccaggaagcctttcgcctcacccagccgcttcatccggcgacccagcaccacc
atctgcccctcacccatcagagtggccttggagagctcatcgggcttggagcagaaaggg
gagtgcagcgggtccatggccccccgtgggccctctgtcaccgagagcagcgaggcctcc
ctcgacacctcctggcctcgcagccggcccagggcccctcctaaggcccgcatggctctg
tccttcagcaggtttctgagacgaggctgtctggcctcacctgtctttgccaggctctca
cccaagtgccctgctgtgtcccacgggagggtgcagcccctgggggacgtgggccagcag
ctgccacgattgaaatccaagagagtagcaaactttttccagatcaaaatggatgtgccc
acggggagcgggacctgcttgatggactcggaggatgctggaacaggagagtcgggtgac
cgggccacagaaaaggaggtcatctgcccctgggagagcctgtaa

DBGET integrated database retrieval system