KEGG   Homo sapiens (human): 8795Help
Entry
8795              CDS       T01001                                 

Gene name
TNFRSF10B, CD262, DR5, KILLER, KILLER/DR5, TRAIL-R2, TRAILR2, TRICK2, TRICK2A, TRICK2B, TRICKB, ZTNFR9
Definition
(RefSeq) TNF receptor superfamily member 10b
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa05162  Measles
hsa05164  Influenza A
Drug target
Conatumumab: D09329
Drozitumab: D09888
Lexatumumab: D06611
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8795 (TNFRSF10B)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    8795 (TNFRSF10B)
   04217 Necroptosis
    8795 (TNFRSF10B)
   04115 p53 signaling pathway
    8795 (TNFRSF10B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    8795 (TNFRSF10B)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05162 Measles
    8795 (TNFRSF10B)
   05164 Influenza A
    8795 (TNFRSF10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8795 (TNFRSF10B)
   04090 CD molecules [BR:hsa04090]
    8795 (TNFRSF10B)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   8795 (TNFRSF10B)
CD molecules [BR:hsa04090]
 Proteins
  8795 (TNFRSF10B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death RskA
Motif
Other DBs
NCBI-GeneID: 8795
NCBI-ProteinID: NP_003833
OMIM: 603612
HGNC: 11905
Ensembl: ENSG00000120889
Vega: OTTHUMG00000097826
Pharos: O14763(Tbio)
UniProt: O14763 Q7Z2I8
Structure
PDB: 

Position
8p21.3
AA seq 440 aa AA seqDB search
MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQD
LAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCD
SGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH
KESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKV
LPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV
NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRK
LGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED
HLLSSGKFMYLEGNADSAMS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacggggacagaacgccccggccgcttcgggggcccggaaaaggcacggccca
ggacccagggaggcgcggggagccaggcctgggccccgggtccccaagacccttgtgctc
gttgtcgccgcggtcctgctgttggtctcagctgagtctgctctgatcacccaacaagac
ctagctccccagcagagagcggccccacaacaaaagaggtccagcccctcagagggattg
tgtccacctggacaccatatctcagaagacggtagagattgcatctcctgcaaatatgga
caggactatagcactcactggaatgacctccttttctgcttgcgctgcaccaggtgtgat
tcaggtgaagtggagctaagtccctgcaccacgaccagaaacacagtgtgtcagtgcgaa
gaaggcaccttccgggaagaagattctcctgagatgtgccggaagtgccgcacagggtgt
cccagagggatggtcaaggtcggtgattgtacaccctggagtgacatcgaatgtgtccac
aaagaatcaggtacaaagcacagtggggaagtcccagctgtggaggagacggtgacctcc
agcccagggactcctgcctctccctgttctctctcaggcatcatcataggagtcacagtt
gcagccgtagtcttgattgtggctgtgtttgtttgcaagtctttactgtggaagaaagtc
cttccttacctgaaaggcatctgctcaggtggtggtggggaccctgagcgtgtggacaga
agctcacaacgacctggggctgaggacaatgtcctcaatgagatcgtgagtatcttgcag
cccacccaggtccctgagcaggaaatggaagtccaggagccagcagagccaacaggtgtc
aacatgttgtcccccggggagtcagagcatctgctggaaccggcagaagctgaaaggtct
cagaggaggaggctgctggttccagcaaatgaaggtgatcccactgagactctgagacag
tgcttcgatgactttgcagacttggtgccctttgactcctgggagccgctcatgaggaag
ttgggcctcatggacaatgagataaaggtggctaaagctgaggcagcgggccacagggac
accttgtacacgatgctgataaagtgggtcaacaaaaccgggcgagatgcctctgtccac
accctgctggatgccttggagacgctgggagagagacttgccaagcagaagattgaggac
cacttgttgagctctggaaagttcatgtatctagaaggtaatgcagactctgccatgtcc
taa

DBGET integrated database retrieval system