KEGG   Homo sapiens (human): 8796
Entry
8796              CDS       T01001                                 
Symbol
SCEL
Name
(RefSeq) sciellin
  KO
K24424  sciellin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    8796 (SCEL)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 LIM domain-containing proteins
  Other lim domain-containing proteins
   8796 (SCEL)
SSDB
Motif
Pfam: IFT43 LIM
Other DBs
NCBI-GeneID: 8796
NCBI-ProteinID: NP_659001
OMIM: 604112
HGNC: 10573
Ensembl: ENSG00000136155
UniProt: O95171
Position
13:77535706..77645263
AA seq 688 aa
MSNVTLRKMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQDNSWIKKRPEEEKDENYGR
VVLNRHNSHDALDRKVNERDVPKATISRYSSDDTLDRISDRNDAAKTYKANTLDNQLTNR
SMSMFRSLEVTKLQPGGSLNANTSNTIASTSATTPVKKKRQSWFPPPPPGYNASSSTGTR
RREPGVHPPIPPKPSSPVSSPNQLRQDNRQIHPPKPGVYTETNRSAERNIRSQDLDNIVK
VATSLQRSDKGEELDNLIKMNKSLNRNQGLDSLFRANPKVEEREKRAKSLESLIYMSTRT
DKDGKGIQSLGSPIKVNQRTDKNEKGRQNLESVAKVNARMNKTSRRSEDLDNATEVNPKG
HENTTGKKDLDGLIKVDPETNKNITRGQSLDNLIKVTPEVKRSNQGSKDLNNFIKVYPGT
EKSTEGGQSLDSLIKVTPERNRTNQGNQDLENLIKVIPSANKSSEQGLDEHINVSPKAVK
NTDGKQDLDKLIKVNPEIFTNNQRNQDLANLIKVNPAVIRNNQSQDLDNLIKVKPSALRN
TNRDQNLENLIEVNSHVSENKNGSSNTGAKQAGPQDTVVYTRTYVENSKSPKDGYQENIS
GKYIQTVYSTSDRSVIERDMCTYCRKPLGVETKMILDELQICCHSTCFKCEICKQPLENL
QAGDSIWIYRQTIHCEPCYSKIMAKWIP
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgtccaatgttaccttgagaaaaatgtctcccacaggaaatgagatgaagagcaccact
cagggaaccacacggaagcagcaggattttcacgaggtgaacaaaagaagaactttctta
caggataacagttggataaagaaacgccctgaagaagaaaaagatgaaaattacggtagg
gtggtgctcaaccgacataattcccatgatgcattggacaggaaagtaaatgagagagat
gtgccaaaagctacaattagtcggtacagttctgatgacactttggacaggatctcagac
agaaatgatgctgctaaaacatataaggccaataccttggataaccaactaaccaatagg
agcatgtccatgtttagatcactggaagtaacaaagttgcaacctggcggttcattgaat
gccaacacctccaacaccatagcatccacttctgctactactcctgtaaagaagaagagg
cagtcctggtttccaccgccccctccaggttacaatgcctcctcgagcacaggaaccagg
agacgggaaccaggtgttcaccctccaatacctccaaagcccagttctcctgtttcttct
cctaaccagctgagacaggataataggcagatacatccacctaaaccaggtgtatataca
gaaaccaacagatctgctgaaagaaatataaggagtcaggatcttgataacatcgtcaaa
gtggccacttcacttcagagaagtgacaaaggtgaagaattggataatctcatcaaaatg
aacaaaagcttgaataggaatcaaggtcttgatagtctcttcagagcaaatccaaaggta
gaagaaagagagaaaagagccaaaagccttgaaagtctcatctatatgagtacccggaca
gataaagatggcaaaggaatccaaagccttggaagtccgattaaagttaatcaaaggact
gacaaaaatgagaaaggaagacaaaatctcgaatctgttgctaaagtgaatgccaggatg
aataaaacgagcagaagaagtgaagaccttgataatgctactgaagtaaatcccaaagga
catgaaaataccactggaaaaaaagaccttgatgggcttattaaagtggatcctgaaaca
aataaaaatattacgaggggccagagccttgataatctcatcaaagtgacccctgaagta
aagagaagtaaccaaggttccaaagaccttaataacttcatcaaagtgtatccaggaaca
gaaaaaagtactgaagggggccaaagtctcgacagcctcattaaagtgactcctgaaaga
aacagaactaaccaagggaaccaagacttggaaaatcttatcaaagtgatcccttcagca
aacaaaagcagtgaacaaggtcttgatgaacatattaatgtcagccccaaagctgtcaaa
aacactgatggaaaacaagatcttgataaactcatcaaggtgaatcctgaaattttcaca
aacaaccaaagaaaccaagatcttgctaacctcatcaaagtaaatcctgcagtaatcaga
aacaatcagagccaagacttggacaatcttattaaagtgaaaccttcagctcttagaaac
actaatcgagaccagaacctggaaaatttaattgaagtaaattctcatgtgtctgaaaac
aagaatggaagctctaacactggagccaagcaggcaggaccacaggatactgttgtgtac
acaaggacatatgtggagaatagtaaatcacccaaggatggatatcaggagaatatctct
ggaaaatacatacaaactgtttattcaacttctgataggtctgtcattgaaagagatatg
tgcacttactgccgaaaacccttgggtgtagaaactaaaatgattttagatgaattacaa
atttgctgccattctacttgctttaagtgtgaaatatgcaagcagcctttggaaaatcta
caagcgggtgatagtatttggatttatagacagacaatacactgtgaaccttgctactct
aaaattatggcaaagtggattccataa

DBGET integrated database retrieval system