KEGG   Homo sapiens (human): 8797Help
Entry
8797              CDS       T01001                                 

Gene name
TNFRSF10A, APO2, CD261, DR4, TRAILR-1, TRAILR1
Definition
(RefSeq) TNF receptor superfamily member 10a
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa05162  Measles
hsa05164  Influenza A
Drug target
Mapatumumab: D04858
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8797 (TNFRSF10A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    8797 (TNFRSF10A)
   04217 Necroptosis
    8797 (TNFRSF10A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    8797 (TNFRSF10A)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05162 Measles
    8797 (TNFRSF10A)
   05164 Influenza A
    8797 (TNFRSF10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8797 (TNFRSF10A)
   04090 CD molecules [BR:hsa04090]
    8797 (TNFRSF10A)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   8797 (TNFRSF10A)
CD molecules [BR:hsa04090]
 Proteins
  8797 (TNFRSF10A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TNFR_c6
Motif
Other DBs
NCBI-GeneID: 8797
NCBI-ProteinID: NP_003835
OMIM: 603611
HGNC: 11904
Ensembl: ENSG00000104689
Vega: OTTHUMG00000097843
Pharos: O00220(Tchem)
UniProt: O00220
Structure
PDB: 

Position
8p21.3
AA seq 468 aa AA seqDB search
MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMG
QHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGT
QQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPC
TTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNI
WVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEIL
SNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADP
TETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTG
RNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaccaccagctagagtacatctaggtgcgttcctggcagtgactccgaatccc
gggagcgcagcgagtgggacagaggcagccgcggccacacccagcaaagtgtggggctct
tccgcggggaggattgaaccacgaggcgggggccgaggagcgctccctacctccatggga
cagcacggacccagtgcccgggcccgggcagggcgcgccccaggacccaggccggcgcgg
gaagccagccctcggctccgggtccacaagaccttcaagtttgtcgtcgtcggggtcctg
ctgcaggtcgtacctagctcagctgcaaccatcaaacttcatgatcaatcaattggcaca
cagcaatgggaacatagccctttgggagagttgtgtccaccaggatctcatagatcagaa
catcctggagcctgtaaccggtgcacagagggtgtgggttacaccaatgcttccaacaat
ttgtttgcttgcctcccatgtacagcttgtaaatcagatgaagaagagagaagtccctgc
accacgaccaggaacacagcatgtcagtgcaaaccaggaactttccggaatgacaattct
gctgagatgtgccggaagtgcagcagagggtgccccagagggatggtcaaggtcaaggat
tgtacgccctggagtgacatcgagtgtgtccacaaagaatcaggcaatggacataatata
tgggtgattttggttgtgactttggttgttccgttgctgttggtggctgtgctgattgtc
tgttgttgcatcggctcaggttgtggaggggaccccaagtgcatggacagggtgtgtttc
tggcgcttgggtctcctacgagggcctggggctgaggacaatgctcacaacgagattctg
agcaacgcagactcgctgtccactttcgtctctgagcagcaaatggaaagccaggagccg
gcagatttgacaggtgtcactgtacagtccccaggggaggcacagtgtctgctgggaccg
gcagaagctgaagggtctcagaggaggaggctgctggttccagcaaatggtgctgacccc
actgagactctgatgctgttctttgacaagtttgcaaacatcgtgccctttgactcctgg
gaccagctcatgaggcagctggacctcacgaaaaatgagatcgatgtggtcagagctggt
acagcaggcccaggggatgccttgtatgcaatgctgatgaaatgggtcaacaaaactgga
cggaacgcctcgatccacaccctgctggatgccttggagaggatggaagagagacatgca
agagagaagattcaggacctcttggtggactctggaaagttcatctacttagaagatggc
acaggctctgccgtgtccttggagtga

DBGET integrated database retrieval system