KEGG   Homo sapiens (human): 8798Help
Entry
8798              CDS       T01001                                 

Gene name
DYRK4
Definition
(RefSeq) dual specificity tyrosine phosphorylation regulated kinase 4
  KO
K18669  dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     8798 (DYRK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   8798 (DYRK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Choline_kinase
Motif
Other DBs
NCBI-GeneID: 8798
NCBI-ProteinID: NP_003836
OMIM: 609181
HGNC: 3095
Ensembl: ENSG00000010219
Vega: OTTHUMG00000168204
Pharos: Q9NR20(Tdark)
UniProt: Q9NR20
Position
12p13.32
AA seq 520 aa AA seqDB search
MPASELKASEIPFHPSIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGY
AELWFLGLEAKKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAK
CLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKDNTYNVVHMKDFFYFRNHFC
ITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQ
KGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTG
YPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSK
DLTMVLKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWIHQSRNLKPQPRPQTLRKSNS
FFPSETRKDKVQGCHHSSRKADEITKETTEKTKDSPTKHVQHSGDQQDCLQHGADTVQLP
QLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNVLPPIV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctcagagctcaaggcttcagaaatacctttccaccctagcattaaaacccag
gatcccaaggcagaggagaagtcaccaaagaagcaaaaggtgactctgacagcggcagag
gccctaaagctttttaagaaccagctgtctccatatgaacaaagtgaaatcctgggctac
gcggagctgtggttcctgggtcttgaagccaagaagctcgacacggctcctgagaaattt
agcaagacgagttttgatgatgagcatggcttctatctgaaggtcctgcatgatcacatt
gcctaccgctatgaagttctggagacaatcgggaaggggtcctttggacaggtggccaag
tgcttggatcacaaaaacaatgagctggtggccctgaaaatcatcaggaacaagaagagg
tttcaccagcaggccctgatggagctgaagatcctggaagctctcagaaagaaggacaaa
gacaacacctacaatgtggtgcatatgaaggactttttctactttcgcaatcacttctgc
atcacctttgagctcctgggaatcaacttgtatgagttgatgaagaataacaactttcaa
ggcttcagtctgtccatagttcggcgcttcactctctctgttttgaagtgcttgcagatg
ctttcggtagagaaaatcattcactgtgatctcaagcccgaaaatatagtgctataccaa
aagggccaagcctctgttaaagtcattgactttggatcaagctgttatgaacaccagaaa
gtatacacgtacatccaaagccggttctaccgatccccagaagtgatcctgggccacccc
tacgacgtggccattgacatgtggagcctgggctgcatcacggcggagttgtacacgggc
taccccctgttccccggggagaatgaggtggagcagctggcctgcatcatggaggtgctg
ggtctgccgccagccggcttcattcagacagcctccaggagacagacattctttgattcc
aaaggttttcctaaaaatataaccaacaacagggggaaaaaaagatacccagattccaag
gacctcacgatggtgctgaaaacctatgacaccagcttcctggactttctcagaaggtgt
ttggtatgggaaccttctcttcgcatgaccccggaccaggccctcaagcatgcttggatt
catcagtctcggaacctcaagccacagcccaggccccagaccctgaggaaatccaattcc
tttttcccctctgagacaaggaaggacaaggttcaaggctgtcatcactcgagcagaaaa
gcagatgagatcaccaaagagactacagagaaaacaaaagatagccccacgaagcatgtt
cagcattcaggtgatcagcaggactgtctccagcacggagctgacactgttcagctgcct
caactggtagacgctcccaagaagtcagaggcagctgtcggggcggaggtgtccatgacc
tccccaggacagagcaaaaacttctccctcaagaacacaaacgttttaccccctattgta
tga

DBGET integrated database retrieval system