KEGG   Homo sapiens (human): 8801Help
Entry
8801              CDS       T01001                                 

Gene name
SUCLG2, G-SCS, GBETA, GTPSCS
Definition
(RefSeq) succinate-CoA ligase GDP-forming beta subunit
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    8801 (SUCLG2)
   00640 Propanoate metabolism
    8801 (SUCLG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8801 (SUCLG2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     8801 (SUCLG2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     8801 (SUCLG2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8801 (SUCLG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-GeneID: 8801
NCBI-ProteinID: NP_003839
OMIM: 603922
HGNC: 11450
Ensembl: ENSG00000172340
Vega: OTTHUMG00000158740
Pharos: Q96I99(Tbio)
UniProt: Q96I99 A0A024R325
Position
3p14.1
AA seq 432 aa AA seqDB search
MASPVAAQAGKLLRALALRPRFLAAGSQAVQLTSRRWLNLQEYQSKKLMSDNGVRVQRFF
VADTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQM
IGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEV
AASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQV
EVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLD
GNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILV
NIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLED
AAKKAVASVAKK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccccgtagcagcgcaggccgggaagcttctgcgagccctagcgctgcggccc
cgcttcctggcggccgggtcccaggcagttcaattaacctccagaagatggctgaacctg
caggaataccagagcaagaaactgatgtctgacaacggagtgagagttcaaagattcttt
gtagcagacactgcaaatgaagctctcgaggctgctaagagactaaatgcaaaagaaatt
gttttaaaagcccagatcttagctggaggaagaggaaaaggtgtcttcaatagtggtttg
aaaggaggtgttcatttaacaaaagaccctaatgttgtgggacagctggctaaacagatg
attgggtacaatctagcgacaaaacaaactccaaaagaaggtgtgaaagttaacaaggtg
atggttgctgaagccttggatatttccagagaaacctacctggcaattctgatggaccgg
tcctgcaatggccccgtgctggtgggcagcccccaggggggcgtcgacattgaagaggtg
gctgcttcaaacccggagctcatttttaaggagcaaattgacatttttgaaggaataaag
gacagccaagctcagcggatggccgaaaatctaggcttcgttgggcctttgaaaagccag
gctgcagatcaaattacgaagctgtataatctcttcctgaaaattgatgctactcaggtg
gaagtgaatccctttggtgaaactccagaaggacaagttgtctgttttgatgccaagata
aactttgatgacaacgcagaattccgacaaaaagacatatttgctatggacgacaaatca
gagaatgagcccattgaaaatgaagctgccaaatatgatctaaaatacataggactagat
gggaacattgcctgctttgtgaatggtgctgggctcgccatggctacttgtgatatcatt
ttccttaatggtgggaagccagccaacttcttggatcttggaggtggtgtaaaggaagct
caagtatatcaagcattcaaattgctcacagctgatcctaaggttgaagccatccttgtc
aatatatttggtggtatcgtcaactgtgccatcattgccaatgggatcaccaaagcctgc
cgggagctagaactcaaggtgcccctggtggtccggcttgaaggaaccaacgtccaagag
gcccagaagatactcaacaacagcggactccccattacttcagccattgacctggaggat
gcagccaagaaggctgtggccagtgtggccaagaagtga

DBGET integrated database retrieval system