KEGG   Homo sapiens (human): 8805Help
Entry
8805              CDS       T01001                                 

Gene name
TRIM24, PTC6, RNF82, TF1A, TIF1, TIF1A, TIF1ALPHA, hTIF1
Definition
(RefSeq) tripartite motif containing 24
  KO
K08881  tripartite motif-containing protein 24 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8805 (TRIM24)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8805 (TRIM24)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     8805 (TRIM24)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  TIF1 family [OT]
   8805 (TRIM24)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    8805 (TRIM24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain zf-B_box PHD zf-RING_UBOX zf-RING_5 zf-RING_2 zf-C3HC4 zf-C3HC4_2 DUF4649 Imm68
Motif
Other DBs
NCBI-GeneID: 8805
NCBI-ProteinID: NP_056989
OMIM: 603406
HGNC: 11812
Ensembl: ENSG00000122779
Vega: OTTHUMG00000155820
Pharos: O15164(Tbio)
UniProt: O15164
Structure
PDB: 

Position
7q33-q34
AA seq 1050 aa AA seqDB search
MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCH
QNIQSRAPKLLPCLHSFCQRCLPAPQRYLMLPAPMLGSAETPPPVPAPGSPVSGSSPFAT
QVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDK
LTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQ
NQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINL
GSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQ
RQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRY
PPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYD
GKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQS
PNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPI
RIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRS
DAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLC
CEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKL
TPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYS
KPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESE
DNKFSDDSDDDFVQPRKKRLKSIEERQLLK
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggcggtggagaaggcggtggcggcggcggcagcggcctcggctgcggcctcc
ggggggccctcggcggcgccgagcggggagaacgaggccgagagtcggcagggcccggac
tcggagcgcggcggcgaggcggcccggctcaacctgttggacacttgcgccgtgtgccac
cagaacatccagagccgggcgcccaagctgctgccctgcctgcactctttctgccagcgc
tgcctgcccgcgccccagcgctacctcatgctgcccgcgcccatgctgggctcggccgag
accccgccacccgtccctgcccccggctcgccggtcagcggctcgtcgccgttcgccacc
caagttggagtcattcgttgcccagtttgcagccaagaatgtgcagagagacacatcata
gataacttttttgtgaaggacactactgaggttcccagcagtacagtagaaaagtcaaat
caggtatgtacaagctgtgaggacaacgcagaagccaatgggttttgtgtagagtgtgtt
gaatggctctgcaagacgtgtatcagagctcatcagagggtaaagttcacaaaagaccac
actgtcagacagaaagaggaagtatctccagaggcagttggtgtcaccagccagcgacca
gtgttttgtccttttcataaaaaggagcagctgaagctgtactgtgagacatgtgacaaa
ctgacatgtcgagactgtcagttgttagaacataaagagcatagataccaatttatagaa
gaagcttttcagaatcagaaagtgatcatagatacactaatcaccaaactgatggaaaaa
acaaaatacataaaattcacaggaaatcagatccaaaacagaattattgaagtaaatcaa
aatcaaaagcaggtggaacaggatattaaagttgctatatttacactgatggtagaaata
aataaaaaaggaaaagctctactgcatcagttagagagccttgcaaaggaccatcgcatg
aaacttatgcaacaacaacaggaagtggctggactctctaaacaattggagcatgtcatg
catttttctaaatgggcagtttccagtggcagcagtacagcattactttatagcaaacga
ctgattacataccggttacggcacctccttcgtgcaaggtgtgatgcatccccagtgacc
aacaacaccatccaatttcactgtgatcctagtttctgggctcaaaatatcatcaactta
ggttctttagtaatcgaggataaagagagccagccacaaatgcctaagcagaatcctgtc
gtggaacagaattcacagccaccaagtggtttatcatcaaaccagttatccaagttccca
acacagatcagcctagctcaattacggctccagcatatgcagcaacaggtaatggctcag
aggcaacaggtgcaacggaggccagcacctgtgggtttaccaaaccctagaatgcagggg
cccatccagcaaccttccatctctcatcagcaaccgcctccacgtttgataaactttcag
aatcacagccccaaacccaatggaccagttcttcctcctcatcctcaacaactgagatat
ccaccaaaccagaacataccacgacaagcaataaagccaaaccccctacagatggctttc
ttggctcaacaagccataaaacagtggcagatcagcagtggacagggaaccccatcaact
accaacagcacatcctctactccttccagccccacgattactagtgcagcaggatatgat
ggaaaggcttttggttcacctatgatcgatttgagctcaccagtgggagggtcttataat
cttccctctcttccggatattgactgttcaagtactattatgctggacaatattgtgagg
aaagatactaatatagatcatggccagccaagaccaccctcaaacagaacggtccagtca
ccaaattcatcagtgccatctccaggccttgcaggacctgttactatgactagtgtacac
cccccaatacgttcacctagtgcctccagcgttggaagccgaggaagctctggctcttcc
agcaaaccagcaggagctgactctacacacaaagtcccagtggtcatgctggagccaatt
cgaataaaacaagaaaacagtggaccaccggaaaattatgatttccctgttgttatagtg
aagcaagaatcagatgaagaatctaggcctcaaaatgccaattatccaagaagcatactc
acctccctgctcttaaatagcagtcagagctctacttctgaggagactgtgctaagatca
gatgcccctgatagtacaggagatcaacctggacttcaccaggacaattcctcaaatgga
aagtctgaatggttggatccttcccagaagtcacctcttcatgttggagagacaaggaaa
gaggatgaccccaatgaggactggtgtgcagtttgtcaaaacggaggggaactcctctgc
tgtgaaaagtgccccaaagtattccatctttcttgtcatgtgcccacattgacaaatttt
ccaagtggagagtggatttgcactttctgccgagacttatctaaaccagaagttgaatat
gattgtgatgctcccagtcacaactcagaaaaaaagaaaactgaaggccttgttaagtta
acacctatagataaaaggaagtgtgagcgcctacttttatttctttactgccatgaaatg
agcctggcttttcaagaccctgttcctctaactgtgcctgattattacaaaataattaaa
aatccaatggatttgtcaaccatcaagaaaagactacaagaagattattccatgtactca
aaacctgaagattttgtagctgattttagattgatctttcaaaactgtgctgaattcaat
gagcctgattcagaagtagccaatgctggtataaaacttgaaaattattttgaagaactt
ctaaagaacctctatccagaaaaaaggtttcccaaaccagaattcaggaatgaatcagaa
gataataaatttagtgatgattcagatgatgactttgtacagccccggaagaaacgcctc
aaaagcattgaagaacgccagttgcttaaataa

DBGET integrated database retrieval system