KEGG   Homo sapiens (human): 8807Help
Entry
8807              CDS       T01001                                 

Gene name
IL18RAP, ACPL, CD218b, CDw218b, IL-18R-beta, IL-18RAcP, IL-18Rbeta, IL-1R-7, IL-1R7, IL-1RAcPL, IL18RB
Definition
(RefSeq) interleukin 18 receptor accessory protein
  KO
K05174  interleukin 18 receptor accessory protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8807 (IL18RAP)
 09160 Human Diseases
  09162 Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    8807 (IL18RAP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8807 (IL18RAP)
   04090 CD Molecules [BR:hsa04090]
    8807 (IL18RAP)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   8807 (IL18RAP)
CD molecules [BR:hsa04090]
 Proteins
  8807 (IL18RAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_2 Ig_3 ig I-set Ig_5 Ig_4 TIR_2
Motif
Other DBs
NCBI-GeneID: 8807
NCBI-ProteinID: NP_003844
OMIM: 604509
HGNC: 5989
Ensembl: ENSG00000115607
Vega: OTTHUMG00000130777
Pharos: O95256(Tbio)
UniProt: O95256
Structure
PDB: 

Position
2q12.1
AA seq 599 aa AA seqDB search
MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRN
RLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNN
SGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCPSLSC
QSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQV
RTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWEV
SVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRGVVL
LYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSF
PSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIFI
LSPNYVNGPSIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWR
GLKSVPPNSRFWAKMRYHMPVKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKEW
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgctctgtttgggctggatatttctttggcttgttgcaggagagcgaattaaaggattt
aatatttcaggttgttccacaaaaaaactcctttggacatattctacaaggagtgaagag
gaatttgtcttattttgtgatttaccagagccacagaaatcacatttctgccacagaaat
cgactctcaccaaaacaagtccctgagcacctgcccttcatgggtagtaacgacctatct
gatgtccaatggtaccaacaaccttcgaatggagatccattagaggacattaggaaaagc
tatcctcacatcattcaggacaaatgtacccttcactttttgaccccaggggtgaataat
tctgggtcatatatttgtagacccaagatgattaagagcccctatgatgtagcctgttgt
gtcaagatgattttagaagttaagccccagacaaatgcatcctgtgagtattccgcatca
cataagcaagacctacttcttgggagcactggctctatttcttgccccagtctcagctgc
caaagtgatgcacaaagtccagcggtaacctggtacaagaatggaaaactcctctctgtg
gaaaggagcaaccgaatcgtagtggatgaagtttatgactatcaccagggcacatatgta
tgtgattacactcagtcggatactgtgagttcgtggacagtcagagctgttgttcaagtg
agaaccattgtgggagacactaaactcaaaccagatattctggatcctgtcgaggacaca
ctggaagtagaacttggaaagcctttaactattagctgcaaagcacgatttggctttgaa
agggtctttaaccctgtcataaaatggtacatcaaagattctgacctagagtgggaagtc
tcagtacctgaggcgaaaagtattaaatccactttaaaggatgaaatcattgagcgtaat
atcatcttggaaaaagtcactcagcgtgatcttcgcaggaagtttgtttgctttgtccag
aactccattggaaacacaacccagtccgtccaactgaaagaaaagagaggagtggtgctc
ctgtacatcctgcttggcaccatcgggaccctggtggccgtgctggcggcgagtgccctc
ctctacaggcactggattgaaatagtgctgctgtaccggacctaccagagcaaggatcag
acgcttggggataaaaaggattttgatgctttcgtatcctatgcaaaatggagctctttt
ccaagtgaggccacttcatctctgagtgaagaacacttggccctgagcctatttcctgat
gttttagaaaacaaatatggatatagcctgtgtttgcttgaaagagatgtggctccagga
ggagtgtatgcagaagacattgtgagcattattaagagaagcagaagaggaatatttatc
ttgagccccaactatgtcaatggacccagtatctttgaactacaagcagcagtgaatctt
gccttggatgatcaaacactgaaactcattttaattaagttctgttacttccaagagcca
gagtctctacctcatctcgtgaaaaaagctctcagggttttgcccacagttacttggaga
ggcttaaaatcagttcctcccaattctaggttctgggccaaaatgcgctaccacatgcct
gtgaaaaactctcagggattcacgtggaaccagctcagaattacctctaggatttttcag
tggaaaggactcagtagaacagaaaccactgggaggagctcccagcctaaggaatggtga

DBGET integrated database retrieval system