KEGG   Homo sapiens (human): 8807Help
Entry
8807              CDS       T01001                                 

Gene name
IL18RAP, ACPL, CD218b, CDw218b, IL-18R-beta, IL-18RAcP, IL-18Rbeta, IL-1R-7, IL-1R7, IL-1RAcPL, IL18RB
Definition
(RefSeq) interleukin 18 receptor accessory protein
  KO
K05174  interleukin 18 receptor accessory protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8807 (IL18RAP)
   04061 Viral protein interaction with cytokine and cytokine receptor
    8807 (IL18RAP)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    8807 (IL18RAP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8807 (IL18RAP)
   04090 CD molecules [BR:hsa04090]
    8807 (IL18RAP)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   8807 (IL18RAP)
CD molecules [BR:hsa04090]
 Proteins
  8807 (IL18RAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_6 Ig_2 Ig_3 ig I-set TIR_2 Ig_4 Ig_5
Motif
Other DBs
NCBI-GeneID: 8807
NCBI-ProteinID: NP_003844
OMIM: 604509
HGNC: 5989
Ensembl: ENSG00000115607
Vega: OTTHUMG00000130777
Pharos: O95256(Tbio)
UniProt: O95256
Structure
PDB: 

Position
2q12.1
AA seq 599 aa AA seqDB search
MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRN
RLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNN
SGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCPSLSC
QSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQV
RTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWEV
SVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRGVVL
LYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSF
PSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIFI
LSPNYVNGPSIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWR
GLKSVPPNSRFWAKMRYHMPVKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKEW
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgctctgtttgggctggatatttctttggcttgttgcaggagagcgaattaaaggattt
aatatttcaggttgttccacaaaaaaactcctttggacatattctacaaggagtgaagag
gaatttgtcttattttgtgatttaccagagccacagaaatcacatttctgccacagaaat
cgactctcaccaaaacaagtccctgagcacctgcccttcatgggtagtaacgacctatct
gatgtccaatggtaccaacaaccttcgaatggagatccattagaggacattaggaaaagc
tatcctcacatcattcaggacaaatgtacccttcactttttgaccccaggggtgaataat
tctgggtcatatatttgtagacccaagatgattaagagcccctatgatgtagcctgttgt
gtcaagatgattttagaagttaagccccagacaaatgcatcctgtgagtattccgcatca
cataagcaagacctacttcttgggagcactggctctatttcttgccccagtctcagctgc
caaagtgatgcacaaagtccagcggtaacctggtacaagaatggaaaactcctctctgtg
gaaaggagcaaccgaatcgtagtggatgaagtttatgactatcaccagggcacatatgta
tgtgattacactcagtcggatactgtgagttcgtggacagtcagagctgttgttcaagtg
agaaccattgtgggagacactaaactcaaaccagatattctggatcctgtcgaggacaca
ctggaagtagaacttggaaagcctttaactattagctgcaaagcacgatttggctttgaa
agggtctttaaccctgtcataaaatggtacatcaaagattctgacctagagtgggaagtc
tcagtacctgaggcgaaaagtattaaatccactttaaaggatgaaatcattgagcgtaat
atcatcttggaaaaagtcactcagcgtgatcttcgcaggaagtttgtttgctttgtccag
aactccattggaaacacaacccagtccgtccaactgaaagaaaagagaggagtggtgctc
ctgtacatcctgcttggcaccatcgggaccctggtggccgtgctggcggcgagtgccctc
ctctacaggcactggattgaaatagtgctgctgtaccggacctaccagagcaaggatcag
acgcttggggataaaaaggattttgatgctttcgtatcctatgcaaaatggagctctttt
ccaagtgaggccacttcatctctgagtgaagaacacttggccctgagcctatttcctgat
gttttagaaaacaaatatggatatagcctgtgtttgcttgaaagagatgtggctccagga
ggagtgtatgcagaagacattgtgagcattattaagagaagcagaagaggaatatttatc
ttgagccccaactatgtcaatggacccagtatctttgaactacaagcagcagtgaatctt
gccttggatgatcaaacactgaaactcattttaattaagttctgttacttccaagagcca
gagtctctacctcatctcgtgaaaaaagctctcagggttttgcccacagttacttggaga
ggcttaaaatcagttcctcccaattctaggttctgggccaaaatgcgctaccacatgcct
gtgaaaaactctcagggattcacgtggaaccagctcagaattacctctaggatttttcag
tggaaaggactcagtagaacagaaaccactgggaggagctcccagcctaaggaatggtga

DBGET integrated database retrieval system