KEGG   Homo sapiens (human): 8809Help
Entry
8809              CDS       T01001                                 

Gene name
IL18R1, CD218a, CDw218a, IL-1Rrp, IL18RA, IL1RRP
Definition
(RefSeq) interleukin 18 receptor 1
  KO
K05173  interleukin 18 receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04668  TNF signaling pathway
hsa05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    8809 (IL18R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8809 (IL18R1)
 09160 Human Diseases
  09162 Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    8809 (IL18R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8809 (IL18R1)
   04090 CD Molecules [BR:hsa04090]
    8809 (IL18R1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   8809 (IL18R1)
CD molecules [BR:hsa04090]
 Proteins
  8809 (IL18R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR V-set Ig_2 Ig_3 I-set TIR_2 Ig_5 Izumo-Ig
Motif
Other DBs
NCBI-GeneID: 8809
NCBI-ProteinID: NP_003846
OMIM: 604494
HGNC: 5988
Ensembl: ENSG00000115604
Vega: OTTHUMG00000130780
Pharos: Q13478(Tbio)
UniProt: Q13478
Structure
PDB: 

Position
2q12.1
AA seq 541 aa AA seqDB search
MNCRELPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS
GSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCF
TERQVTSKIVEVKKFFQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQ
GYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSAL
LNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTV
ASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYR
HLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVT
DFTFLPQSLKLLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDEPEVLPVLSE
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtagagaattacccttgaccctttgggtgcttatatctgtaagcactgcagaa
tcttgtacttcacgtccccacattactgtggttgaaggggaacctttctatctgaaacat
tgctcgtgttcacttgcacatgagattgaaacaaccaccaaaagctggtacaaaagcagt
ggatcacaggaacatgtggagctgaacccaaggagttcctcgagaattgctttgcatgat
tgtgttttggagttttggccagttgagttgaatgacacaggatcttactttttccaaatg
aaaaattatactcagaaatggaaattaaatgtcatcagaagaaataaacacagctgtttc
actgaaagacaagtaactagtaaaattgtggaagttaaaaaattttttcagataacctgt
gaaaacagttactatcaaacactggtcaacagcacatcattgtataagaactgtaaaaag
ctactactggagaacaataaaaacccaacgataaagaagaacgccgagtttgaagatcag
gggtattactcctgcgtgcatttccttcatcataatggaaaactatttaatatcaccaaa
accttcaatataacaatagtggaagatcgcagtaatatagttccggttcttcttggacca
aagcttaaccatgttgcagtggaattaggaaaaaacgtaaggctcaactgctctgctttg
ctgaatgaagaggatgtaatttattggatgttcggggaagaaaatggatcggatcctaat
atacatgaagagaaagaaatgagaattatgactccagaaggcaaatggcatgcttcaaaa
gtattgagaattgaaaatattggtgaaagcaatctaaatgttttatataattgcactgtg
gccagcacgggaggcacagacaccaaaagcttcatcttggtgagaaaagcagacatggct
gatatcccaggccacgtcttcacaagaggaatgatcatagctgttttgatcttggtggca
gtagtgtgcctagtgactgtgtgtgtcatttatagagttgacttggttctattttataga
catttaacgagaagagatgaaacattaacagatggaaaaacatatgatgcttttgtgtct
tacctaaaagaatgccgacctgaaaatggagaggagcacacctttgctgtggagattttg
cccagggtgttggagaaacattttgggtataagttatgcatatttgaaagggatgtagtg
cctggaggagctgttgttgatgaaatccactcactgatagagaaaagccgaagactaatc
attgtcctaagtaaaagttatatgtctaatgaggtcaggtatgaacttgaaagtggactc
catgaagcattggtggaaagaaaaattaaaataatcttaattgaatttacacctgttact
gacttcacattcttgccccaatcactaaagcttttgaaatctcacagagttctgaagtgg
aaggccgataaatctctttcttataactcaaggttctggaagaaccttctttacttaatg
cctgcaaaaacagtcaagccaggtagagacgaaccggaagtcttgcctgttctttccgag
tcttaa

DBGET integrated database retrieval system