KEGG   Homo sapiens (human): 8811Help
Entry
8811              CDS       T01001                                 

Gene name
GALR2, GAL2-R, GALNR2, GALR-2
Definition
(RefSeq) galanin receptor 2
  KO
K04231  galanin receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8811 (GALR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8811 (GALR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Galanin
    8811 (GALR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv Flavi_capsid
Motif
Other DBs
NCBI-GeneID: 8811
NCBI-ProteinID: NP_003848
OMIM: 603691
HGNC: 4133
Ensembl: ENSG00000182687
Vega: OTTHUMG00000167479
Pharos: O43603(Tchem)
UniProt: O43603
Position
17q25.1
AA seq 387 aa AA seqDB search
MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT
NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS
APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI
VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ
PCILEPCPGPSWQGPKAGDSILTVDVA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtctcgggctgcccaggggccgggaacgcgagccaggcgggcggcgggggaggc
tggcaccccgaggcggtcatcgtgcccctgctcttcgcgctcatcttcctcgtgggcacc
gtgggcaacacgctggtgctggcggtgctgctgcgcggcggccaggcggtcagcactacc
aacctgttcatccttaacctgggcgtggccgacctgtgtttcatcctgtgctgcgtgccc
ttccaggccaccatctacaccctggacggctgggtgttcggctcgctgctgtgcaaggcg
gtgcacttcctcatcttcctcaccatgcacgccagcagcttcacgctggccgccgtctcc
ctggacaggtatctggccatccgctacccgctgcactcccgcgagctgcgcacgcctcga
aacgcgctggcagccatcgggctcatctgggggctgtcgctgctcttctccgggccctac
ctgagctactaccgccagtcgcagctggccaacctgaccgtgtgccatcccgcgtggagc
gcccctcgccgccgcgccatggacatctgcaccttcgtcttcagctacctgcttcctgtg
ctggttctcggcctgacctacgcgcgcaccttgcgctacctctggcgcgccgtcgacccg
gtggccgcgggctcgggtgcccggcgcgccaagcgcaaggtgacacgcatgatcctcatc
gtggccgcgctcttctgcctctgctggatgccccaccacgcgctcatcctctgcgtgtgg
ttcggccagttcccgctcacgcgcgccacttatgcgcttcgcatcctctcgcacctggtc
tcctacgccaactcctgcgtcaaccccatcgtttacgcgctggtctccaagcacttccgc
aaaggcttccgcacgatctgcgcgggcctgctgggccgtgccccaggccgagcctcgggc
cgtgtgtgcgctgccgcgcggggcacccacagtggcagcgtgttggagcgcgagtccagc
gacctgttgcacatgagcgaggcggcgggggcccttcgtccctgccccggcgcttcccag
ccatgcatcctcgagccctgtcctggcccgtcctggcagggcccaaaggcaggcgacagc
atcctgacggttgatgtggcctga

DBGET integrated database retrieval system