KEGG   Homo sapiens (human): 8812Help
Entry
8812              CDS       T01001                                 

Gene name
CCNK, CPR4, IDDHDF
Definition
(RefSeq) cyclin K
  KO
K23326  cyclin K
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    8812 (CCNK)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     8812 (CCNK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_C_2 PDZ_3
Motif
Other DBs
NCBI-GeneID: 8812
NCBI-ProteinID: NP_001092872
OMIM: 603544
HGNC: 1596
Ensembl: ENSG00000090061
Vega: OTTHUMG00000171495
Pharos: O75909(Tbio)
UniProt: O75909 A0A024R6K1
Structure
PDB: 

Position
14q32.2
AA seq 580 aa AA seqDB search
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDV
GTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTA
RSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQK
LVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQ
DVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPS
QPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEPPPPKIPKIET
THPPLPPAHPPPDRKPPLAAALGEAEPPGPVDATDLPKVQIPPPAHPAPVHQPPPLPHRP
PPPPPSSYMTGMSTTSSYMSGEGYQSLQSMMKTEGPSYGALPPAYGPPAHLPYHPHVYPP
NPPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGL
PPASYPPPAVPPGGQPPVPPPIPPPGMPPVGGLGRAAWMR
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagaataaagaaaattcaagcccttcagtaacttcagcaaacctggaccacaca
aagccatgttggtactgggataagaaagacttggctcatacaccctcacaacttgaagga
cttgatccagccaccgaggcccggtaccgccgagagggcgctcggttcatctttgatgtg
ggcacacgtttggggctacactatgataccctggcaactggaataatttattttcatcgc
ttctatatgtttcattccttcaagcaattcccaagatatgtgacaggagcctgttgcctc
tttctggctgggaaagtagaagaaacaccaaaaaaatgtaaagatatcatcaaaacagct
cgtagtttattaaatgatgtacaatttggccagtttggagatgacccaaaggaggaagta
atggttctggagagaatcttactgcagaccatcaagtttgatttacaggtagaacatcca
taccagttcctactaaaatatgcaaagcaactcaaaggtgataaaaacaaaattcaaaag
ttggttcaaatggcatggacatttgtaaatgacagtctctgcaccaccttgtcactgcag
tgggaaccagagatcatagcagtagcagtgatgtatctcgcaggacgtttgtgcaaattt
gaaatacaagaatggacctccaaacccatgtataggagatggtgggagcagtttgttcaa
gatgtcccggtcgacgttttggaagacatctgccaccaaatcctggatctttactcacaa
ggaaaacaacagatgcctcatcacaccccccatcagctgcaacagcccccatctcttcag
cctacaccacaagtgccgcaagtacagcagtcacagccgtctcaaagctccgaaccatcc
cagccccagcagaaggacccccagcaaccagcccagcagcagcagccagcccaacagccc
aagaaaccctctccgcagcccagttctccccgacaggttaagcgagccgtggttgtttct
cccaaagaagagaacaaagcagcagaaccaccaccacctaaaatccccaaaattgagacc
actcatccaccgttgcctccagcccacccacctccagaccggaagcctcccctcgctgct
gccttaggtgaggctgagccgccgggccctgtggatgccactgacctccccaaagtccag
attccccctccggcccacccggcccctgtgcaccagccaccgccgctgccacaccggccc
ccgcccccacccccctccagctacatgaccgggatgtccaccaccagctcctacatgtct
ggagagggctaccagagcctgcagtccatgatgaagaccgagggaccctcctacggtgcc
ctgccccccgcctacggcccacctgcacacctgccctaccacccccatgtctacccgccc
aacccgcccccgccacctgtgcctcctcccccagcctccttccccccacctgccatccca
ccccctactcctggctaccccccacccccacccacctacaaccccaacttcccaccccca
cccccacgcctcccgcctacccacgcagtcccccctcatcctcctccagggttgggcctg
ccgccagccagctacccacctcctgccgtcccccctggaggacagcctcctgtgcccccg
cccattcccccacccggcatgcctccagttggggggctggggcgggcagcctggatgaga
taa

DBGET integrated database retrieval system