KEGG   Homo sapiens (human): 8814Help
Entry
8814              CDS       T01001                                 

Gene name
CDKL1, KKIALRE, P42
Definition
(RefSeq) cyclin dependent kinase like 1
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8814 (CDKL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     8814 (CDKL1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   8814 (CDKL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 8814
NCBI-ProteinID: NP_004187
OMIM: 603441
HGNC: 1781
Ensembl: ENSG00000100490
Vega: OTTHUMG00000140290
Pharos: Q00532(Tdark)
UniProt: Q00532
Structure
PDB: 

Position
14q21.3
AA seq 358 aa AA seqDB search
MMEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLK
HPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHK
HNCIHRDVKPENILITKHSVIKLCDFGFARLLTGPSDYYTDYVATRWYRSPELLVGDTQY
GPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVK
IPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKE
HNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgatggagaagtatgaaaaaattgggaaaattggagaaggatcctatggagttgttttc
aaatgtagaaacagggacacgggtcagattgtggccatcaagaagtttctggaatcagaa
gatgaccctgtcataaagaaaattgcccttcgggaaatccgaatgctcaagcaactcaag
catcccaaccttgttaacctcctggaagtcttcaggaggaaacggaggcttcacctggtg
tttgaatattgtgaccacacagttctccatgagttggacagataccaaagaggggtacca
gaacatctcgtgaagagcataacttggcagacactgcaagctgtaaatttttgccataaa
cacaattgcatacatagagacgtgaagccagaaaatatcctcatcacgaaacattccgtg
attaagctttgtgactttggatttgctcggcttttgactggaccgagtgactactataca
gactacgtggctaccaggtggtaccgctcccctgagctgctggtgggggacacgcagtac
ggccccccggtggatgtttgggcaattggctgtgtctttgctgagctgctgtcaggagtg
cctctgtggccaggaaaatcggatgtggatcagctgtatctgattaggaagaccttgggg
gatctcattcctaggcaccagcaagtgtttagcacgaatcagtacttcagtggagtgaaa
attccagaccctgaagatatggaaccacttgaattaaaattcccaaacatctcttatcct
gccctggggctcctaaagggctgtctccacatggaccctactcaaaggctgacatgtgaa
cagctgttgcatcacccatattttgaaaacatcagagaaatagaggatttggcaaaagaa
cacaacaaaccaacaaggaagaccctaagaaagagccgaaagcaccactgctttacagaa
acatccaagttgcagtacctaccccagctaactggcagcagcatccttccagctttggat
aataagaagtactactgtgataccaagaaacttaactaccgttttccaaacatttaa

DBGET integrated database retrieval system