KEGG   Homo sapiens (human): 8825
Entry
8825              CDS       T01001                                 

Gene name
LIN7A, LIN-7A, LIN7, MALS-1, MALS1, TIP-33, VELI1
Definition
(RefSeq) lin-7 homolog A, crumbs cell polarity complex component
  KO
K19931  protein lin-7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8825 (LIN7A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    8825 (LIN7A)
SSDB
Motif
Pfam: PDZ L27 PDZ_6 PDZ_2 CREPT DUF932 7TMR-HDED
Other DBs
NCBI-GeneID: 8825
NCBI-ProteinID: NP_004655
OMIM: 603380
HGNC: 17787
Ensembl: ENSG00000111052
Vega: OTTHUMG00000170168
Pharos: O14910(Tbio)
UniProt: O14910
Position
12q21.31
AA seq 233 aa
MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSE
FCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGF
NVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKD
SVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQTQQNHMS
NT seq 702 nt   +upstreamnt  +downstreamnt
atgctgaagccgagcgtcacttcggctcccacggcagacatggcgacattgacagtggtc
cagccgctcaccctggacagagatgttgcaagagcaattgaattactggaaaaactacag
gaatctggagaagtaccagtgcacaagctacaatccctcaaaaaagtgcttcagagtgag
ttttgtacagctattcgagaggtgtatcaatatatgcatgaaacgataactgttaatggc
tgtcccgaattccgtgcgagggcaacagcaaaggcaacagttgcagcttttgcagctagt
gaaggccactcccaccctcgagtagttgaactgccaaagactgatgaaggccttggtttt
aatgtgatgggaggaaaggagcaaaattcccccatttatatctctcgcataattcctgga
ggggtggctgaaagacacggaggcctcaaaagaggagaccagctgctatcagtgaacgga
gtgagtgtggaaggagaacaccatgagaaagctgtggaactactcaaggctgctaaagac
agcgtcaagctggtggtgcgatacaccccaaaagttctggaagaaatggaggctcgcttt
gaaaagctacgaacagccaggcgtcggcagcagcagcaattgctaattcagcagcagcaa
cagcagcagcagcaacaaacacaacaaaaccacatgtcatag

DBGET integrated database retrieval system