KEGG   Homo sapiens (human): 8828Help
Entry
8828              CDS       T01001                                 

Gene name
NRP2, NP2, NPN2, PRO2714, VEGF165R2
Definition
(RefSeq) neuropilin 2
  KO
K06819  neuropilin 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8828 (NRP2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    8828 (NRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUB F5_F8_type_C DUF3481 MAM
Motif
Other DBs
NCBI-GeneID: 8828
NCBI-ProteinID: NP_957718
OMIM: 602070
HGNC: 8005
Ensembl: ENSG00000118257
Vega: OTTHUMG00000132893
Pharos: O60462(Tbio)
UniProt: O60462 Q7Z3T9
Structure
PDB: 

Position
2q33.3
AA seq 931 aa AA seqDB search
MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSML
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYS
DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQD
PRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPTEEEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYD
HAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQY
QATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEIAIDDIRISTDVPLENCMEPISAFAGENFKVDIPEIHEREGYEDEIDDEYEVDWSNS
SSATSGSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSR
SCTTLENYNFELYDGLKHKVKMNHQKCCSEA
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggatatgtttcctctcacctgggttttcttagccctctacttttcaagacaccaagtg
agaggccaaccagacccaccgtgcggaggtcgtttgaattccaaagatgctggctatatc
acctctcccggttacccccaggactacccctcccaccagaactgcgagtggattgtttac
gcccccgaacccaaccagaagattgtcctcaacttcaaccctcactttgaaatcgagaag
cacgactgcaagtatgactttatcgagattcgggatggggacagtgaatccgcagacctc
ctgggcaaacactgtgggaacatcgccccgcccaccatcatctcctcgggctccatgctc
tacatcaagttcacctccgactacgcccggcagggggcaggcttctctctgcgctacgag
atcttcaagacaggctctgaagattgctcaaaaaacttcacaagccccaacgggaccatc
gaatctcctgggtttcctgagaagtatccacacaacttggactgcacctttaccatcctg
gccaaacccaagatggagatcatcctgcagttcctgatctttgacctggagcatgaccct
ttgcaggtgggagagggggactgcaagtacgattggctggacatctgggatggcattcca
catgttggccccctgattggcaagtactgtgggaccaaaacaccctctgaacttcgttca
tcgacggggatcctctccctgacctttcacacggacatggcggtggccaaggatggcttc
tctgcgcgttactacctggtccaccaagagccactagagaactttcagtgcaatgttcct
ctgggcatggagtctggccggattgctaatgaacagatcagtgcctcatctacctactct
gatgggaggtggacccctcaacaaagccggctccatggtgatgacaatggctggaccccc
aacttggattccaacaaggagtatctccaggtggacctgcgctttttaaccatgctcacg
gccatcgcaacacagggagcgatttccagggaaacacagaatggctactatgtcaaatcc
tacaagctggaagtcagcactaatggagaggactggatggtgtaccggcatggcaaaaac
cacaaggtatttcaagccaacaacgatgcaactgaggtggttctgaacaagctccacgct
ccactgctgacaaggtttgttagaatccgccctcagacctggcactcaggtatcgccctc
cggctggagctcttcggctgccgggtcacagatgctccctgctccaacatgctggggatg
ctctcaggcctcattgcagactcccagatctccgcctcttccacccaggaatacctctgg
agccccagtgcagcccgcctggttagcagccgctcgggctggttccctcgaatccctcag
gcccagcccggtgaggagtggcttcaggtagatctgggaacacccaagacagtgaaaggt
gtcatcatccagggagcccgcggaggagacagtatcactgctgtggaagccagagcattt
gtgcgcaagttcaaagtctcctacagcctaaacggcaaggactgggaatacattcaggac
cccaggacccagcagccaaagctgttcgaagggaacatgcactatgacacccctgacatc
cgaaggtttgaccccattccggcacagtatgtgcgggtatacccggagaggtggtcgccg
gcggggattgggatgcggctggaggtgctgggctgtgactggacagactccaagcccacg
gtagagacgctgggacccactgtgaagagcgaagagacaaccaccccctaccccaccgaa
gaggaggccacagagtgtggggagaactgcagctttgaggatgacaaagatttgcagctc
ccttcgggattcaattgcaacttcgatttcctcgaggagccctgtggttggatgtatgac
catgccaagtggctccggaccacctgggccagcagctccagcccaaacgaccggacgttt
ccagatgacaggaatttcttgcggctgcagagtgacagccagagagagggccagtatgcc
cggctcatcagcccccctgtccacctgccccgaagcccggtgtgcatggagttccagtac
caggccacgggcggccgcggggtggcgctgcaggtggtgcgggaagccagccaggagagc
aagttgctgtgggtcatccgtgaggaccagggcggcgagtggaagcacgggcggatcatc
ctgcccagctacgacatggagtaccagattgtgttcgagggagtgatagggaaaggacgt
tccggagagattgccattgatgacattcggataagcactgatgtcccactggagaactgc
atggaacccatctcggcttttgcaggtgagaattttaaagtggacatcccagaaatacat
gagagagaaggatatgaagatgaaattgatgatgaatacgaggtggactggagcaattct
tcttctgcaacctcagggtctggcgccccctcgaccgacaaagaaaagagctggctgtac
accctggatcccatcctcatcaccatcatcgccatgagctcactgggcgtcctcctgggg
gccacctgtgcaggcctcctgctctactgcacctgttcctactcgggcctgagctcccga
agctgcaccacactggagaactacaacttcgagctctacgatggccttaagcacaaggtc
aagatgaaccaccaaaagtgctgctccgaggcatga

DBGET integrated database retrieval system