KEGG   Homo sapiens (human): 8829Help
Entry
8829              CDS       T01001                                 

Gene name
NRP1, BDCA4, CD304, NP1, NRP, VEGF165R
Definition
(RefSeq) neuropilin 1
  KO
K06724  neuropilin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa05166  HTLV-I infection
Drug target
Vesencumab: D10494
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    8829 (NRP1)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    8829 (NRP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    8829 (NRP1)
CD molecules [BR:hsa04090]
 Proteins
  8829 (NRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUB F5_F8_type_C DUF3481 MAM
Motif
Other DBs
NCBI-GeneID: 8829
NCBI-ProteinID: NP_003864
OMIM: 602069
HGNC: 8004
Ensembl: ENSG00000099250
Vega: OTTHUMG00000019343
Pharos: O14786(Tbio)
UniProt: O14786 Q68DN3 Q6AWA9 Q59F20
Structure
PDB: 

Position
10p11.22
AA seq 923 aa AA seqDB search
MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLF
IKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAP
KMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSS
GILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN
WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKI
DVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE
VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSY
INEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSF
EGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLV
DECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTF
CHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAH
CMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVI
FEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGEGD
KNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYN
FELVDGVKLKKDKLNTQSTYSEA
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggagagggggctgccgctcctctgcgccgtgctcgccctcgtcctcgccccggccggc
gcttttcgcaacgataaatgtggcgatactataaaaattgaaagccccgggtaccttaca
tctcctggttatcctcattcttatcacccaagtgaaaaatgcgaatggctgattcaggct
ccggacccataccagagaattatgatcaacttcaaccctcacttcgatttggaggacaga
gactgcaagtatgactacgtggaagtcttcgatggagaaaatgaaaatggacattttagg
ggaaagttctgtggaaagatagcccctcctcctgttgtgtcttcagggccatttcttttt
atcaaatttgtctctgactacgaaacacatggtgcaggattttccatacgttatgaaatt
ttcaagagaggtcctgaatgttcccagaactacacaacacctagtggagtgataaagtcc
cccggattccctgaaaaatatcccaacagccttgaatgcacttatattgtctttgcgcca
aagatgtcagagattatcctggaatttgaaagctttgacctggagcctgactcaaatcct
ccaggggggatgttctgtcgctacgaccggctagaaatctgggatggattccctgatgtt
ggccctcacattgggcgttactgtggacagaaaacaccaggtcgaatccgatcctcatcg
ggcattctctccatggttttttacaccgacagcgcgatagcaaaagaaggtttctcagca
aactacagtgtcttgcagagcagtgtctcagaagatttcaaatgtatggaagctctgggc
atggaatcaggagaaattcattctgaccagatcacagcttcttcccagtatagcaccaac
tggtctgcagagcgctcccgcctgaactaccctgagaatgggtggactcccggagaggat
tcctaccgagagtggatacaggtagacttgggccttctgcgctttgtcacggctgtcggg
acacagggcgccatttcaaaagaaaccaagaagaaatattatgtcaagacttacaagatc
gacgttagctccaacggggaagactggatcaccataaaagaaggaaacaaacctgttctc
tttcagggaaacaccaaccccacagatgttgtggttgcagtattccccaaaccactgata
actcgatttgtccgaatcaagcctgcaacttgggaaactggcatatctatgagatttgaa
gtatacggttgcaagataacagattatccttgctctggaatgttgggtatggtgtctgga
cttatttctgactcccagatcacatcatccaaccaaggggacagaaactggatgcctgaa
aacatccgcctggtaaccagtcgctctggctgggcacttccacccgcacctcattcctac
atcaatgagtggctccaaatagacctgggggaggagaagatcgtgaggggcatcatcatt
cagggtgggaagcaccgagagaacaaggtgttcatgaggaagttcaagatcgggtacagc
aacaacggctcggactggaagatgatcatggatgacagcaaacgcaaggcgaagtctttt
gagggcaacaacaactatgatacacctgagctgcggacttttccagctctctccacgcga
ttcatcaggatctaccccgagagagccactcatggcggactggggctcagaatggagctg
ctgggctgtgaagtggaagcccctacagctggaccgaccactcccaacgggaacttggtg
gatgaatgtgatgacgaccaggccaactgccacagtggaacaggtgatgacttccagctc
acaggtggcaccactgtgctggccacagaaaagcccacggtcatagacagcaccatacaa
tcagagtttccaacatatggttttaactgtgaatttggctggggctctcacaagaccttc
tgccactgggaacatgacaatcacgtgcagctcaagtggagtgtgttgaccagcaagacg
ggacccattcaggatcacacaggagatggcaacttcatctattcccaagctgacgaaaat
cagaagggcaaagtggctcgcctggtgagccctgtggtttattcccagaactctgcccac
tgcatgaccttctggtatcacatgtctgggtcccacgtcggcacactcagggtcaaactg
cgctaccagaagccagaggagtacgatcagctggtctggatggccattggacaccaaggt
gaccactggaaggaagggcgtgtcttgctccacaagtctctgaaactttatcaggtgatt
ttcgagggcgaaatcggaaaaggaaaccttggtgggattgctgtggatgacattagtatt
aataaccacatttcacaagaagattgtgcaaaaccagcagacctggataaaaagaaccca
gaaattaaaattgatgaaacagggagcacgccaggatacgaaggtgaaggagaaggtgac
aagaacatctccaggaagccaggcaatgtgttgaagaccttagaccccatcctcatcacc
atcatagccatgagtgccctgggggtcctcctgggggctgtctgtggggtcgtgctgtac
tgtgcctgttggcataatgggatgtcagaaagaaacttgtctgccctggagaactataac
tttgaacttgtggatggtgtgaagttgaaaaaagacaaactgaatacacagagtacttat
tcggaggcatga

DBGET integrated database retrieval system